SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005166 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000005166
Domain Number - Region: 258-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00981
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005166   Gene: ENSBTAG00000003960   Transcript: ENSBTAT00000005166
Sequence length 1006
Comment pep:known_by_projection chromosome:UMD3.1:25:17247411:17264312:1 gene:ENSBTAG00000003960 transcript:ENSBTAT00000005166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEYEKFCEKSLSRIQEASLSTESFLPVQSESISLIRFHGVAVLSPLLNIEKRKEMQQEK
QKALDVEARRQVNRKKALLSRVQEILENVQVRKAPDASDFHQWETETVYSNSEVRNLNVP
ATLPNILPSPTEHSTLAEFEKITGILPLNNEDRFKSNRIDLARDSEELSYLKQCDSSNIS
QAENEASLKTSSTAAQETLTSDVLFPTNEEQDPSLLEEVTPDPYIMSLQNLMKKSKEYIE
REQSRRSLRSSVKRSVNESHSDKENDAVKVTDNGKEKSPLIGKHCGSVIPDKPSLNKSNV
LLQGAFTQASSMNTSVLGNFSKVDISIRTGHTTVLETDSNFQGIPTFVTENNVIKSLTGS
YAKIPSPEPSLSPKMHRRRSRPSSACHILINNPINASELSPKGKEQAVELVVQETDEKTN
VPETVPKLPVCSSKVYVSKNTEAIQEMVLGKSNQVCQPSGNQLENKVIHGLAIMEGQLIS
DARGPHRVDSTCTAGERLHEPYATRECVLSQNFGSVSGVKSTNVLEKNSCNLQMELNKSY
DVKNPSPLLMQNQNTRQQMDTPTVSCGKEQFLDNSFGKVKRRLDLDIDNLQKENYPYVVT
TGIAEQERQHLPEKRYSKGSVYIKNKMLESSSKEGEEILKSKILAFEEMRKRLEEQHAQQ
LSLLIAEQEREQERLQKDIEEQEKMLKEKTIITAEASELDISNAVDFGWRKISDSGLLDT
VLSQVDSLHTSNSNSSGFTSSALQHSFASANEVPFYLWGSSSSGLTKLSVTRPFGRAKTK
WSQVFSPEVQAKLNKVTAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSEAPLKRG
VVSAQDASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHHDREVRKEKMLRQMDKMKS
PRVALSAATQKSLDRKKYMKAAEMGMPSKKFLVKQNPSETRVLQPNQGQNAPVHRLLSRQ
GTPKTSVKGVVQNRQKSSQSRVPSRAPVSGVYAGKIQRKRPNVATI
Download sequence
Identical sequences E1BGQ5
9913.ENSBTAP00000005166 XP_003584070.1.59421 XP_003587867.1.76553 XP_005196988.1.59421 XP_005196989.1.59421 XP_005224836.1.76553 XP_005224837.1.76553 XP_010817643.1.76553 XP_010817644.1.76553 XP_010824074.1.59421 XP_010824075.1.59421 ENSBTAP00000005166 ENSBTAP00000005166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]