SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005195 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005195
Domain Number 1 Region: 49-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-72
Family Lectin leg-like 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005195   Gene: ENSBTAG00000003975   Transcript: ENSBTAT00000005195
Sequence length 359
Comment pep:known chromosome:UMD3.1:11:2653390:2672003:-1 gene:ENSBTAG00000003975 transcript:ENSBTAT00000005195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALGPSGWWQRWRRRLSAREVSRMLLLLLLLGSGQGPRQVGAGQTFEYLKREHSLSKP
YQGVGTSSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFRIHGQ
GKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQEAQKRRYSPGVQ
RVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDID
GKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDV
FLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQDQSRKRFY
Download sequence
Identical sequences L8IW18
ENSBTAP00000005195 9913.ENSBTAP00000005195 ENSBTAP00000046571 NP_001014953.1.59421 NP_001014953.1.76553 XP_005891679.1.15283 XP_019825270.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]