SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005227 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005227
Domain Number 1 Region: 220-460
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-82
Family Eukaryotic proteases 0.0000000219
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 6.08e-25
Family GLA-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 133-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family EGF-type module 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005227   Gene: ENSBTAG00000004003   Transcript: ENSBTAT00000005227
Sequence length 462
Comment pep:known chromosome:UMD3.1:X:23025837:23059616:1 gene:ENSBTAG00000004003 transcript:ENSBTAT00000005227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCLNMIMAESPGLVTICLLGYLLSAECTVFLDRENATKILHRPKRYNSGKLEEFVRGNL
ERECKEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGMCKDDINSYECWCQ
AGFEGTNCELDATCSIKNGRCKQFCKRDTDNKVVCSCTDGYRLAEDQKSCEPAVPFPCGR
VSVSHISKKLTRAETIFSNTNYENSSEAEIIWDNVTQSNQSFDEFSRVVGGEDAERGQFP
WQVLLHGEIAAFCGGSIVNEKWVVTAAHCIKPGVKITVVAGEHNTEKPEPTEQKRNVIRA
IPYHSYNASINKYSHDIALLELDEPLELNSYVTPICIADRDYTNIFLKFGYGYVSGWGKV
FNRGRSASILQYLKVPLVDRATCLRSTKFSIYSHMFCAGYHEGGKDSCQGDSGGPHVTEV
EGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
Download sequence
Identical sequences P00741
9913.ENSBTAP00000005227 ENSBTAP00000005227 XP_005227591.1.76553 XP_019811788.1.53367 ENSBTAP00000005227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]