SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005240 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005240
Domain Number 1 Region: 818-959
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-18
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 923-1051
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 659-785
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 580-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000454
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 5 Region: 422-528,579-622
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000832
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005240   Gene: ENSBTAG00000004014   Transcript: ENSBTAT00000005240
Sequence length 1160
Comment pep:known_by_projection chromosome:UMD3.1:22:58990282:59038424:-1 gene:ENSBTAG00000004014 transcript:ENSBTAT00000005240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLGEPMGAWLALALALALSPGGAAAPGQDCTGVECPPLENCIEDALEPGACCATCVQR
GCACEGYQYYDCLQGGFVRGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMPCPELPPNC
IEAVVAADSCPQCGQVGCVHSGRKYAAGHTVRLAPCRACHCPDAGGELICYPLPDCHGDA
APGNTSDAEDGDPERHYEDPYSYDQEVAEAEALAGELQAGAGGPAALGGGGQPPSALQAT
LWPAALPRPTAAAALGPPAPVQAKARRVTDDGQEDREVPAVQEQLAAGGPRGLDGRPTAG
PMPAHPVREEGAEARAGVEENLIPDVQATHRSAGPPPTFSMPNILLTETTQGPPEAPTEP
SAHAALTTLQQETARAPPTQEVPQQPAGPRSRLEEEEDPNSVHSVPRAGLEVSTKDLIET
CCAAGQQWAIDSDECLDIPESGAEGDACRTAQKQCCVSYLKEKSCMAGVLGAKEGEACGD
EDSDTCGVSLYKQCCDCCGLGLRVRAEGQSCESNPNLGYPCNHVMLSCCEGEDPLIVPEV
RRPPEPEAVPRRVSEAELASREALSLGTETELPNSLPGDDQDECLLLPGELCQHLCINTV
GSYRCACFPGFSLQDDGRTCRPEGAPPKPEAAEESAQRPESAQVAPNTIALPVPQPNTCQ
DNGPCKQVCRVVGDTAMCSCFPGYAIMADGVSCEDINECVTDLHTCSRREHCVNTVGSFH
CYKALTCEPGYRLEDGECTDVDECELGTHNCQAGAVCHNTKGSFYCQARQRCLEGFLQDP
EGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNPVICGRGYHASQDGTKCVDVNECET
GVHRCGEGQVCHNLPGSYRCDCKPGFQRDAFGRTCIDVNECWTSPTRLCQHTCENTLGSY
RCSCASGFLLAADGKHCEDVNECEAQRCSQECANIYGSYQCYCRQGYQLAEDGHTCTDID
ECAQGASILCTFRCINVPGSYQCTCPERGYTMTANGRSCKDLDECALGTHNCSEAETCHN
IQGGFRCLRFDCPPNYVRVSETKCERALCHDFLECQNAPARITHYRLNFQTGLLVPAHIF
RISPVPAFAGDTIALTITKGNEEGYFGTRRLNAYTGVVFLQRTVREPRDFALDVEMKLWR
QGSVTTFLAKMHIFFTAFAL
Download sequence
Identical sequences E1BEB4
ENSBTAP00000005240 XP_015315190.1.76553 XP_015324299.1.59421 ENSBTAP00000005240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]