SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005255 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005255
Domain Number 1 Region: 622-807
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000406
Family Mannose 6-phosphate receptor domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000005255
Domain Number - Region: 291-360,397-418
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000314
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005255   Gene: ENSBTAG00000004023   Transcript: ENSBTAT00000005255
Sequence length 960
Comment pep:known_by_projection chromosome:UMD3.1:4:33518953:33763007:1 gene:ENSBTAG00000004023 transcript:ENSBTAT00000005255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFLRPGPARGRGRGRPARAPHSGLSPPWSPAWICCWALAGCQAAWAGAGDLPSTSGRPL
PPCLEKDYHFEYTECDSSGSRWRVAIPNSAVDCSGLPDPVRGKECTFSCASGEYLEMKNQ
VCSKCGEGTYSLGSGIKFDEWDELPAGFSNVATFMDTVVGPSDSRPEGCNNSSWVPRGNY
IESNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCQEMDTTADKWVKLT
DNGEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTF
SDKPGSFICQVCPRNTYSEKGAKECIRCDEDSQFSEEGSSECMERPPCTSKDYFQIHTPC
DEEGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTF
SDGTKECRSCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSG
AGGSDNDYLILNLHIPGFKPPTSMTGAMGSELGRITFVFETLCSADCVLYFMVDINRKST
NVVESWGGTKEKQAYTHVIFKNATFTFTWAFQRTNQGQDATTLRKKPTSAWSVHLIPTCP
YIRSMARRLVFHVGLGVEALSNLSSVGSLMNGPSFTSKGTKYFHFFNISLCGHEGKKLAV
CTNNITDFTVKEMVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADTFLGVT
VETTLQNINIKEDMFPVSPSQIPDVHFFYKSSTTTTSCVNGRSTAVKMRCNPAKPGAGAI
SVPSKCPAGTCDGCTFYFLWESVEACPLCTEHDFHEIEGACKRGFQETLYVWNEPKWCIK
GISLPEKKLSTCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKYSKLVMTTNS
KECELPAADSCAIMEGEDNEEEVVYSNKQSLLGKLKSLATKEKEDHFESVQLKSSRSPNI
Download sequence
Identical sequences A7E2Z9
ENSBTAP00000005255 NP_001039703.2.59421 NP_001039703.2.76553 ENSBTAP00000005255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]