SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005335 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005335
Domain Number 1 Region: 221-386,418-480
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-38
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 483-672
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.76e-32
Family cAMP-binding domain 0.00061
Further Details:      
 
Domain Number 3 Region: 40-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.01e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005335   Gene: ENSBTAG00000001195   Transcript: ENSBTAT00000005335
Sequence length 1063
Comment pep:known_by_projection chromosome:UMD3.1:19:42922699:42938502:-1 gene:ENSBTAG00000001195 transcript:ENSBTAT00000005335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDITQSGGPGLGPPGGHGDSNHENSLGRRGASSRLRSARRQSRTVLHRLT
GHFGRRGQGGMKTNNVFEPKPSVPEYKVASVGGSRCLLLHYSVPKAVWDGLILLATFYVA
VTVPYNVCFSGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVVSAPRSIG
LHYLATWFFVDLIAALPFDLLYVFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVV
LTLLMSVFALLAHWMACVWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSAGGPS
RRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRM
YSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELRA
DIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSL
EVLRDNMVLAILGKGDLIGADIPEPGSGTAPSCVLKTSADVKALTYCGLQQLSSQGLAEV
LRLYPEYGAAFRAGLPRDLTFNLRHGSETNGLCRFSRSPRLSQPRSDSLGSSSDKTQPSV
TEAEAGAEPGGGPRPRRPILLPNLSPARPRGSLVSLLGEELPPFSALVSSPSLSPAPSPA
LAGRGHSPSPHGPPRGSAAWKPPQLLIPPLGTFGPPDLSPRIVDGIEDSGSTAEATTFRF
SRRPEHPRSRSQALPIASAQSSGGNTCVLRRMVPDQSTKSHDKNGAPRDLKATSTAQPGP
ALGNGPSLGSDKHQASPGVHLGGASPGSVGFKISRLNREVSQLSQELRHMMGLLQARLGP
PGHPTVSAWPPHPPCPLQRPPCSSPYMSGPPPGLHDTTRAEVHCPASVGTAEMGAAHPDL
RPSVRSPYLSEPDPLGPSPVPEAPPSNSSLMRHSFRSRSDTIH
Download sequence
Identical sequences E1BLH0
ENSBTAP00000005335 ENSBTAP00000005335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]