SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005348 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005348
Domain Number 1 Region: 503-653
Classification Level Classification E-value
Superfamily EF-hand 4.61e-51
Family Osteonectin 0.00000248
Further Details:      
 
Domain Number 2 Region: 447-500
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000166
Family Ovomucoid domain III-like 0.00039
Further Details:      
 
Domain Number 3 Region: 421-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000158
Family Follistatin (FS) module N-terminal domain, FS-N 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005348   Gene: ENSBTAG00000004094   Transcript: ENSBTAT00000005348
Sequence length 654
Comment pep:known chromosome:UMD3.1:6:104149824:104202396:-1 gene:ENSBTAG00000004094 transcript:ENSBTAT00000005348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTVVFFLCILGTAGAIPTQARFLSDHSNPTADSLSFFQEAETSEHTAIPLVEVEDAENE
KETATSIEDHSHHKPEKSSLLKSEEENHDQSADQEESYNQNLGLQDQEKTESDLTENLEY
SPTEGTLELKEDMSEPQKEKLPESFLAHDVSSIVDSNQQESITKTEENQKQPVDDSHPQL
NSQDLRDQGNQDQDTNGEEEGEKEPGEVGTHNDEEERETELPKEPSNNKQEEDSTQSDAV
LEESYQPTQESKMQKEELEHGSREQEEENTNAEMEEETASKIDKPSQDTEWQSQEGKPGP
EVISNHEEMDKKTLSEPLLVEPTDDVNEVAINHGAKDDSDDGPGYNESEDDFTPSEEFLS
NERAQSMYYHLEYEEQIENALKNENVDSSETVENQQAKKAESSLKEDEHSTEGNTRVHSV
DSCLSFQCKRGHICKADQHGKPYCVCQDPASCPPTKLLDQVCGTDNQTYASSCHLFATKC
RMERTKKGHQLHLDYFGACKTIPACTDFEVTQFPLRMRDWLKNILVQLYEPNPEHSGYLN
EKQRNKVKKIYLDEKRLLAGDHSIDLLLRDFKKNYHMYVYPVHWQFSELDQHPRDRVLTH
SELAPLRASLVPMEHCITRFFEECDPNKDKHITLQEWGHCFEIKEEDIDENLLF
Download sequence
Identical sequences Q3SYW7
NP_001029474.1.59421 NP_001029474.1.76553 ENSBTAP00000005348 9913.ENSBTAP00000005348 ENSBTAP00000005348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]