SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005431 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005431
Domain Number 1 Region: 36-134
Classification Level Classification E-value
Superfamily Immunoglobulin 4.12e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 178-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000905
Family EGF-type module 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005431   Gene: ENSBTAG00000004150   Transcript: ENSBTAT00000005431
Sequence length 241
Comment pep:known chromosome:UMD3.1:27:27624065:27833020:1 gene:ENSBTAG00000004150 transcript:ENSBTAT00000005431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERREGKGKGKGGKKDRGSGKKPVPAAGGPSPALPPRLKEMKSQESVAGSKLVLRCETS
SEYSSLKFKWFKNGSELSRKNKPQNIKIQKRPGKSELRISKASLADSGEYMCKVISKLGN
DSASANITIVESNEITTGMPASTETAYVSSESPIRISVSTEGTNTSSSTSTSTAGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYSTSTPFLSLP
E
Download sequence
Identical sequences Q07112
NP_776553.1.59421 NP_776553.1.76553 ENSBTAP00000005431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]