SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005469 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005469
Domain Number 1 Region: 11-368
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 6.45e-90
Family Extradiol dioxygenases 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005469   Gene: ENSBTAG00000004175   Transcript: ENSBTAT00000005469
Sequence length 393
Comment pep:known chromosome:UMD3.1:17:55707870:55719927:1 gene:ENSBTAG00000004175 transcript:ENSBTAT00000005469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYSDKGEKPERGRFLHFHSVTFWVGNAKQAASYYCSKLGFEPLAYKGLETGSREVVSH
VVKQGQIVFVFSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIVRE
PWVEQDKLGKVKFAVLQTYGDTTHTLVEKMNYTGRFLPGFEAPPFMDPQLSKLPSCSLEI
IDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSVVVANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTKDIITAIRHLRERGVEFLAVPSTYYKQLR
EKLKMAKIRVKENIDILEELKILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFG
AGNFNSLFKAFEEEQDLRGNLTDMEPNGVVSGM
Download sequence
Identical sequences Q5EA20
NP_001015611.1.59421 NP_001015611.1.76553 XP_010839637.1.44457 9913.ENSBTAP00000005469 ENSBTAP00000005469 ENSBTAP00000005469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]