SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005506 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005506
Domain Number 1 Region: 155-255,422-493
Classification Level Classification E-value
Superfamily TrmE connector domain 2.35e-41
Family TrmE connector domain 0.0027
Further Details:      
 
Domain Number 2 Region: 106-186,223-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-35
Family G proteins 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005506   Gene: ENSBTAG00000004200   Transcript: ENSBTAT00000005506
Sequence length 493
Comment pep:known_by_projection chromosome:UMD3.1:7:5709942:5713187:-1 gene:ENSBTAG00000004200 transcript:ENSBTAT00000005506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLVSRAARGPHSPRLCTRQGSGYRAPGSGATIFALSSGQGRCGIAVIRTSGPAS
GHALQSLTAPRDLPLARKACLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCAEFHVHGG
PAVVSGVLQALGSVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLADLIHAETEAQRRQALR
QLDGELGDLCRGWAETLTKALAHVEAYIDFSEDDNLEEGVLDQADSEVRKLEVALGVHLR
DARRGQRLRSGAHVVVAGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFP
ALLSDTAGLREGVGPVEQEGVRRAQKRLEQADLILAVLDASDLASPASCNFLDTVVIPAG
ARNPNGSRQRLLLVLNKSDLLPAGRSDLHPDLPSHLLLSCLTGEGLDGLLEALKKELAAL
CGDPSTGPLLTRSRHQHHLRGCLDALGQYKQAKDLALAAEALRVARGHLSHLTGGGGTEE
ILDIIFRDFCVGK
Download sequence
Identical sequences E1BH64
ENSBTAP00000005506 ENSBTAP00000005506 9913.ENSBTAP00000005506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]