SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005510 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005510
Domain Number 1 Region: 49-227
Classification Level Classification E-value
Superfamily L domain-like 8.26e-37
Family Ngr ectodomain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005510   Gene: ENSBTAG00000004206   Transcript: ENSBTAT00000005510
Sequence length 311
Comment pep:known_by_projection chromosome:UMD3.1:15:81672293:81677418:1 gene:ENSBTAG00000004206 transcript:ENSBTAT00000005510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVQHHCCPQLKMGDAWAHRPWPGPPRPALLLVPLLVAAGVIPSDGGASCPVLCTCHNQ
AVDCSGQRLFSVPPELPVDTRNLSLAHNRIAAVPPGYLTCYQELRVLSLRNNSLVELPAG
LFLHAKRLAHLDLSYNNLSHVPAGMFQAAHSLMRIDLSHNPGLRRVHPLAFQGLAQLRDL
DLSFGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAEC
RGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCH
RWSKASEEEEI
Download sequence
Identical sequences E1BH53
9913.ENSBTAP00000005510 ENSBTAP00000005510 XP_002693803.1.76553 XP_872037.1.59421 ENSBTAP00000005510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]