SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005529 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005529
Domain Number 1 Region: 24-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000108
Family Growth factor receptor domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005529   Gene: ENSBTAG00000004221   Transcript: ENSBTAT00000005529
Sequence length 184
Comment pep:known chromosome:UMD3.1:20:24131984:24140817:1 gene:ENSBTAG00000004221 transcript:ENSBTAT00000005529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLLLLATLLVPAHLAAVWSRKYAVDCPERCDSSQCKSSSRCKRTVLDDCGCCRVCAAG
LGETCYRTVSGMDGVKCGPGLRCQFYNEEDDFGDEFGICKDCPFGTFGMECKQICSCQSG
ICNRVTGKCLKFPFFQYSVAKATNQRFVSHTEHDVASGDGNAVREELVKENDAPSPVMKW
LNPR
Download sequence
Identical sequences A5D7V3 L8J4E2
9913.ENSBTAP00000005529 ENSBTAP00000005529 NP_001091570.1.59421 NP_001091570.1.76553 XP_005887431.1.15283 XP_010855464.1.44457 XP_019838714.1.53367 ENSBTAP00000005529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]