SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005537 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005537
Domain Number 1 Region: 22-195
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.36e-34
Family Laminin G-like module 0.000000503
Further Details:      
 
Domain Number 2 Region: 221-393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000056
Family Laminin G-like module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005537   Gene: ENSBTAG00000004226   Transcript: ENSBTAT00000005537
Sequence length 401
Comment pep:known chromosome:UMD3.1:19:27955573:27960099:1 gene:ENSBTAG00000004226 transcript:ENSBTAT00000005537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRGPLAIWHGLLLLLLLPLPSHGGPALRPPLPSQTTEDSPALHLSSGPGQEPVTIMTF
NLTKITKISSSFEFRTWDPEGVIFYGDTNPKNDWFMLGLRDGRPEIQLHNHWAQLTVSAG
PRLDDGKWHQMEVKIHGDSLLLRVDGVEVLCLRQVFGQQANNSQLIMRIALGGLLFPASD
LRLPLVPALDACLRQDDWLDQQAQTSASVPTSVRSCAVESQPGIFFPPGTGAEFGLQEIP
RPHAEPWAFSLDLALQLAAGSGRLLALGTPENPSWLSIHLQDQKVVLSSGSGPGLDLPLI
LGLRLQLNLTVSGVVLSQGAKKEILALPPTGPGSLLDLWVQPHGRLFLGALPGEATSASF
CLDGLWAQGRSLDMDRAQSRSLNIWTHSCPQNPGNGSDTTH
Download sequence
Identical sequences A5PKC2
ENSBTAP00000005537 NP_001092328.1.59421 NP_001092328.1.76553 ENSBTAP00000005537 9913.ENSBTAP00000005537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]