SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005549 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005549
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000716
Family EGF-type module 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005549   Gene: ENSBTAG00000004237   Transcript: ENSBTAT00000005549
Sequence length 178
Comment pep:known chromosome:UMD3.1:6:91430305:91480129:-1 gene:ENSBTAG00000004237 transcript:ENSBTAT00000005549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAAPGSGASPLPLLPALALGLVILHCVLADGNSTRSPEDDGLLCGDHAENCPATTTQP
KRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFYLRGDRGQIL
VICLIAVMVIFIILVVSICTCCHPLRKRRKRRKKEEEMETLGKDITPINDDIQETSIA
Download sequence
Identical sequences A2VE27
NP_776321.2.59421 NP_776321.2.76553 XP_005891319.1.15283 XP_010836470.1.44457 9913.ENSBTAP00000005549 ENSBTAP00000005549 ENSBTAP00000005549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]