SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005575 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005575
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.06e-72
Family Alanine racemase-like, N-terminal domain 0.000000000654
Further Details:      
 
Domain Number 2 Region: 262-424
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.02e-49
Family Eukaryotic ODC-like 0.000000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005575   Gene: ENSBTAG00000004256   Transcript: ENSBTAT00000005575
Sequence length 461
Comment pep:known chromosome:UMD3.1:11:87178098:87182503:1 gene:ENSBTAG00000004256 transcript:ENSBTAT00000005575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSFSNEEFDCHFLDEGFTAKDILDQKINEVSYSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQ
TGSDDEEESTDRTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQLMQQI
RTQDFPPGVEEPDVGPLPVSCAWESGMKRHSAACASTRINV
Download sequence
Identical sequences L8HNA3 P27117
9913.ENSBTAP00000005575 ENSBTAP00000005575 ENSBTAP00000005575 NP_776555.1.59421 NP_776555.1.76553 XP_005212975.1.76553 XP_005212976.1.76553 XP_005911366.1.15283 XP_010808467.1.76553 XP_010850361.1.44457 XP_010850362.1.44457 XP_010850363.1.44457 XP_015329013.1.76553 XP_019826270.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]