SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005747 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005747
Domain Number 1 Region: 34-248
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 6.44e-50
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005747   Gene: ENSBTAG00000004379   Transcript: ENSBTAT00000005747
Sequence length 254
Comment pep:known chromosome:UMD3.1:18:52048413:52065702:-1 gene:ENSBTAG00000004379 transcript:ENSBTAT00000005747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSVLKIAGRRLSQHTGSGAPVLLRQMFEPKSCTYTYLLGDRESREAVLIDPVLETAQR
DAQLVKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADWHIEDGDSI
QFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAETLYHSVHE
KIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEFVKVMDKLNLPKPQQIDFA
VPANMRCGIQTPPS
Download sequence
Identical sequences Q3T094
ENSBTAP00000005747 NP_001029516.1.59421 NP_001029516.1.76553 ENSBTAP00000005747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]