SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005771 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005771
Domain Number 1 Region: 42-382
Classification Level Classification E-value
Superfamily L domain-like 9.35e-57
Family Ngr ectodomain-like 0.004
Further Details:      
 
Domain Number 2 Region: 426-513
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 526-616
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000011
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005771   Gene: ENSBTAG00000004399   Transcript: ENSBTAT00000005771
Sequence length 708
Comment pep:known_by_projection chromosome:UMD3.1:4:57586911:57589037:-1 gene:ENSBTAG00000004399 transcript:ENSBTAT00000005771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDLPLQIHVLLGLAITTLVQAVDKKADCPQLCTCEIRPWFTPRSIYMEASTVDCNDLGL
SNFPARLPADTQILLLQTNNIAKIEYSIDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLS
VYLEENKLTELPEKCLSGLSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN
SKWFEALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALVGLENLES
ISFYDNRLIKVPNVALQKAVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISI
DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYQGTVESLPNL
KEISIHSNPIRCDCVIRWINMNKTNIRFMEPESLFCVDPPEFQGQNVRQVHFREMMEICL
PLIAPESFPSNLDLEAGSYVSLHCRATAEPQPEIYWITPSGKKLLPNTLTNKFYVHSEGT
LDISGITPAEGGLYTCIATNLVGADLKSVMIKVDGSLPQDNNGSLNIKIKDVQANSVLVS
WKASSKILKSSIKWTAFVKAENSHAAQSARIPSDVKVYNLTHLNPATEYKICIDIPTIYQ
TSRKQCVNVTTKGLDPDQKEYEKNNTTTFMACLGGSLGIIGVICLFSFLSQEVNCDGGHN
YVRNYLQKPTFAFSELYPPLINLWETGKEKGTALEVKATVIGVPTNMS
Download sequence
Identical sequences F1MSM1
ENSBTAP00000005771 ENSBTAP00000005771 XP_002686856.1.76553 XP_588627.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]