SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005777 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005777
Domain Number 1 Region: 51-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000668
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 2 Region: 113-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005777   Gene: ENSBTAG00000004403   Transcript: ENSBTAT00000005777
Sequence length 255
Comment pep:known chromosome:UMD3.1:7:18183237:18187953:-1 gene:ENSBTAG00000004403 transcript:ENSBTAT00000005777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGWVARGLARRAAALGLGLRVLLCFGLCLEIAPTPIQTWSPTQAPGPSAGSCPPTNFQC
RSDGRCLPLIWRCDVDQDCPDGSDEEECGTEVPNGSPSPCDIMDDCPDHNKNLLNCGPQS
CPEGELCCPLDGVCIPSTWLCDGHRDCSDYSDELGCGTKTHEEGRTMSTGTPVTLENVTY
LSNATVTAIEDWDSVQSGNRNVYGIIAAVAVLSISLAAGILFALSRLCAQGCLAPLGLLV
SMKGSLQPEKKTSVL
Download sequence
Identical sequences A6QNY1
ENSBTAP00000005777 ENSBTAP00000005777 NP_001160030.1.59421 NP_001160030.1.76553 XP_019819840.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]