SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005817 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005817
Domain Number 1 Region: 144-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000221
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 2 Region: 64-184,279-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000471
Family Growth factor receptor domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005817   Gene: ENSBTAG00000025410   Transcript: ENSBTAT00000005817
Sequence length 295
Comment pep:known chromosome:UMD3.1:23:27024477:27027205:-1 gene:ENSBTAG00000025410 transcript:ENSBTAT00000005817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRAEPCTVLGGLWFLLLLMTGEGAKGGALKESQGVCSKQTLVVPLRYNESYSQPVYKP
YLTLCSGRRVCSTYRTTYRVAWREVRREVRQTHAVCCQGWKKRHPGALTCDEAICAKPCQ
NGGVCVRPDQCECARGWGGKHCHVDVDECRTGVTLCSHRCLNTAGSFTCGCPHGLVLGLD
GRTCAERAPEPPTSASILNVAVREAGLDKRALRREIGELRGRLERLEQWAGQAGAWVRAV
LPVPPEELQPEQVAELWGQGDRIESLSDQVLLLEERLGTCSCEDNSLGPGLKGRR
Download sequence
Identical sequences A6H775 L8I6P0
ENSBTAP00000005817 NP_001092657.1.59421 NP_001092657.1.76553 XP_005901681.1.15283 XP_010816660.1.76553 9913.ENSBTAP00000005817 ENSBTAP00000005817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]