SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005971 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005971
Domain Number 1 Region: 294-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-42
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily RING/U-box 2.01e-27
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 3 Region: 88-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-17
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000005971
Domain Number - Region: 132-221
Classification Level Classification E-value
Superfamily OmpH-like 0.00275
Family OmpH-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005971   Gene: ENSBTAG00000038536   Transcript: ENSBTAT00000005971
Sequence length 498
Comment pep:known chromosome:UMD3.1:15:48428346:48445590:-1 gene:ENSBTAG00000038536 transcript:ENSBTAT00000005971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGILMNIQEEVTCPICLELLTEPLSLDCGHSFCQACITANNKESIIGQEGKRSCPVCR
VSFEPGNLRPNRHVANIVQRLREVKVSPEVEQERNLCAHHGEKLQLFCEQDGKVICWLCE
RSQEHRAHNTFLMEEIAPEYQKKLQSCLQRLKGKKQEAEELEIKVREEMSTWKIQIENEI
QNVQGKFTQLRQILDSEEMKELRKLKDELGVILKELAESENDLVQEKLLVSNLISDVERH
LQGSTMELLQDANVIIKRSETLALKKPKSFPKEQRRVFRVPDLRQTLHVFNELTDVQRYW
VQVTLNSPKSENVVISPDQRQVRYASSDQCYNAYWNDNYEDFGVLGSPVITSGRHYWEVD
VSKKSAWILGVCGEKCEDIMKLPSKLGNCGNGNCQNVYSRYQPKNGYWVIGLKHYCVYNA
FDASSFSDPVILPLSLSVSLHRVGVFLDYEAHTVLFLNVTNHGFPICQFSSCSFPQNIVP
YFNPMNCGVPMTLCSPSC
Download sequence
Identical sequences Q3MJK3
9913.ENSBTAP00000005971 NP_001029970.1.59421 NP_001029970.1.76553 XP_005216200.1.76553 ENSBTAP00000005971 ENSBTAP00000005971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]