SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005988 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005988
Domain Number 1 Region: 3172-3435
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-50
Family YWTD domain 0.00000352
Further Details:      
 
Domain Number 2 Region: 368-631
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-46
Family YWTD domain 0.00000617
Further Details:      
 
Domain Number 3 Region: 1428-1673
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-44
Family YWTD domain 0.0000101
Further Details:      
 
Domain Number 4 Region: 2362-2605
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-43
Family YWTD domain 0.00000793
Further Details:      
 
Domain Number 5 Region: 684-941
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-42
Family YWTD domain 0.0000249
Further Details:      
 
Domain Number 6 Region: 4029-4299
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-40
Family YWTD domain 0.0000319
Further Details:      
 
Domain Number 7 Region: 1720-1984
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-38
Family YWTD domain 0.0000933
Further Details:      
 
Domain Number 8 Region: 2037-2308
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-34
Family YWTD domain 0.000055
Further Details:      
 
Domain Number 9 Region: 240-255,286-359,624-680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000392
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 10 Region: 3116-3163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000243
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 1239-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 12 Region: 3691-3728
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 13 Region: 1120-1158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 14 Region: 1080-1117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 15 Region: 3898-3935
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 16 Region: 154-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 17 Region: 2706-2748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 3766-3807
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 1-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 74-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 2956-2999
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 22 Region: 193-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 2874-2910
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 24 Region: 3040-3080
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 2828-2868
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 1039-1076
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 27 Region: 3600-3639
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 28 Region: 996-1034
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 2997-3039
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 3726-3766
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 31 Region: 1159-1197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 3813-3849
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 3483-3517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 34 Region: 1327-1371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000046
Family EGF-type module 0.013
Further Details:      
 
Domain Number 35 Region: 2784-2830
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 3558-3602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 37 Region: 39-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 38 Region: 1202-1238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 39 Region: 3082-3130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family EGF-type module 0.017
Further Details:      
 
Domain Number 40 Region: 2746-2788
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 41 Region: 3519-3561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 42 Region: 1364-1404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000742
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 43 Region: 2670-2708
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 44 Region: 3855-3893
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 45 Region: 1284-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 46 Region: 3650-3690
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 47 Region: 120-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 48 Region: 3980-4014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000466
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 49 Region: 2914-2957
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 50 Region: 1677-1713,1983-2034
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000132
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 51 Region: 3942-3981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000217
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005988   Gene: ENSBTAG00000004555   Transcript: ENSBTAT00000005988
Sequence length 4626
Comment pep:known_by_projection chromosome:UMD3.1:2:26936763:27078521:1 gene:ENSBTAG00000004555 transcript:ENSBTAT00000005988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRSNEFLCQPGLCITASWRCDGTRDCPNGADEIDCPTSSCHSNQFLCPNEQLCIPESWVC
DGEDDCNDGADERRHCPGITCSSRQFTCENGECIPGEFRCDHSTDCLDGTDEKNCRYPVC
EQLTCADGACYNTSQRCNGQVDCRDASDERNCTHRCTRTEFQCGSGQCIPRTYVCDHEID
CEDGSDEHSCPAYRTCKGNEFTCPNGVCIAQSWVCDGESDCVDNADEDGCESKINRTFEC
YPNEWACPKSGKCIPISKVCDGTLDCPGGEDESNITAGQQCDVNLCPSLGCEYQCHRSPG
GGMCYCPSGFIVNQNRTNNCVDFDDCQIWGVCDQLCEDRIGHHRCNCVEGYVLERQKHCR
ANSSFGEAFVIFSNGRNLLKGSIRGNNFQILAESQNRGLAVGVDFHYRLRRVFWTDIVQK
KVFSVDISGSRIREVLGVSIEDPENLAVDWVNNKLYIVETRVNCIDVVDLDGSHRITLIS
EYLGHPRGIAVDPTVGYLFFSDWQNVFGVPRIERAYMDGSNRKDLVTTKLGWPGGITLDL
VSKRVYWVDSRFDYIETVTYDGLKRMTVIHGGADIPHPFSISLFEGQLFFTDWTKMAVLK
ANKFKETNPRLYYRSSLKPFGVTVYHGLRQPYARNPCAHENGGCQHICVLSHRTFNGGLG
YRCKCRLGYIPDWDDYHCVAAERFLLFSSNLAVRGIPLTLSHQTEVILPVTGSSSIFLGI
DFDAREKAIFFSDTKKNIIYRQKLDGTGREIITANRVPAVQSLSFDWISRNLYWTDSSYR
SVSVIRLGDKSRRTIIQNLNNPQSIVVHPTAGYIFFSVWYRPAKILRAWADGSNILPIVN
TTLGWPSGLSIDWSSSRLYWVDAFFDKIEHSKLDGSDRKALTNVHQLTHPFGLAVSQDYI
YVTDWRRGIIRFGKYNPGQSIILRSGVGSVMRAKVYDSRVQTGSNACSRPTNPNGDCSHF
CFPVPNSQRVCGCPYGMSLASDHLTCVENASREPPVEQCGTLSFSCHNGRCVPLQYRCDG
FDDCLDNSDEAQCTTSNATCSPLAFECKREGHCIPSMWRCDGEDDCLDGSDEQNCPTRAP
TSCRADQFTCDNNFCIPRSWVCDTDNDCKDGSDEKSCNYTQTCSPTQFHCPDHRCIALTF
VCDGTKDCADGSDEIGCVINCTASQFTCVSNGQCISKTYRCDGVFDCDDHSDETDCPTRP
PGMCHQDEFQCQEDGICIPKTWECDGHEDCLQGSDEHNGCPPKTCHPSHFVCQNGNCIYR
NWLCDGDNDCGDMSDEKDCPTQPFQCPSWQWQCPGHSICVNLSAVCDGVSDCPGGTDESP
LCNQNSCSDSNGGCTHQCIQGPYGAQCQCPLGYLLGNDSKTCEDIDECRTPGFCSQYCYN
MRGSFRCWCDSEYTLDADRRTCKATGNEKSETLLLVASQSQLVAGNMTQNGYFVYPVIQH
GSHIVAVDFDSVSGRIFWSDGTQGKIWSAFQNGTDKKLILDSGVSMTGSIAVDWIGRNLY
WTDISLRTIDVAKLDGSHKTVLISENITNLGGLAVDPRATDRVMFWSDWGSHPRIERASM
DGSQRTIIVQEKIYWPNGLALDYPNRLLYFMDGYLDYLDFCHYDGSNRRQVIASDLILRH
PYSISLFEDTVYWSDRATHEVMKANKWHGGNQSVVMTLHQPLGIVVVHPAKQPVSSNPCS
YTRCSHLCLLSSKSLYSCACPSGWSLARDSVTCVRDDQAFLIVVRNSIIFGISLNPDVKT
FDGMVPISGIRNGYDVAVDYSEQFIYWLENPGEIHRVKTDGTNRTVFAPLSSLGASASLA
LDWLSRNLYFTDHVTRSIKVMTLQGDVSYRKTLIANDGTSLGVGLPVGITIDPINGKLYW
SDRGTNSGLPPKIASANMDGKSPRTLFTGSLENVAFITLDIEEQKLYWAVSSTGVIERGN
VDGTNRMILVNHLSYPWGLAVHGRFLYYSDEEYEVIERVDKATGANKVVLRNNLPDLRGL
KIYQRRECSESSNGCSNNMNACQQICLPVPGRLFSCACATGFKLNPDHQTCSPYNSFIVV
STLRTIRGFSLQLSDHSEAMVPVAGPGRNALHVDVDVSSGFIYWCDFNISVASNNAIRRI
KPDGSNFTNIVTDGIGVNGVRGIAVDWVAGNLYFTNAFRSETLIEVLRINTTHRHILLKT
IVDMPRDIVVDPKNRYLFWSDYGQNPKIERSFLDCTNRTVLVSDITATPRGLALDHSSNY
IYWVDDAVDLIARISIEGGETEVIRFGSHYPAPYAITVFGNSIIWVDRNLKKILQASKEP
NRADRPTVIRDNIDWLRDVTIFDQSVQPRSPAEVNNNPCLENNGGCAQFCFALPKSQTPK
CDCAFGTLQADGKSCAISSENFLIFALDDSLRSLRFDPKDYSQPFPAISVERMAVALDYD
SIDNRIYFTQLLPSGKGQISYINLNSRSSPPTVVVSGIGSPEGIAFDWINKRIYYSDYTN
QMIKSIATDGSRHTLIAQVPKPRGIVLDPCQGYMYWTDWGTNAKIEMATMGGYSRRSLVD
RGLVWPNGLTLDYEQNLIYWADANLEKIERMDLEHYLREVIVSRANSPFGLAIYGQYVYW
TDLLTQKIYRANKVDGSGQTAVTVTLPFRPKGIRAVVKDQQQCLSPCDRFNGGCSHICAP
GPNGAECQCPHEGRWYLANNNKYCIQDNGTRCDSSKFTCLSGKCIPDQLQCNDIDDCGDS
SDELETLCAFHSCPSTSFTCANGRCVPYSDRCDHYNDCGDNSDEAGCHFRACNRTEFTCS
NGRCIPSELVCDGVDNCLDNSASDEKNCPERTCHTGYVKCTNSTICIPRSFLCDGDNDCG
DMSDENPLFCATRSCGSDEFHCTSGPCIPARWYCDHEKDCSDGSDEPPTCEFSQSTCASD
YFKCDNNRCIPMMWVCDGDNDCGDMSDEDERHNCKNRNCSSSEFACEVGVRPHRGCIPKS
WVCDGEADCLDALDEHQNCTRRSCFGTEFVCNNGLCIPNHFRCDRNNDCGDYSDERGCVY
PTCDETLFTCQNGLCINKAYVCDGDNDCKDNSDELEHLCHTPETTCPPHQFRCDNGNCIE
MMKVCNNFPDCSDNSDEKGCGINECNDPTLSGCNQNCTDTLTSFYCSCNPGYKLLSDKRT
CVDIDECEETPFVCSQKCENLPGTYICKCAPGYIREPDGKTCRQNSNIEPDLIFSNRYYL
RNLTVYGHLYSLILQGLGNVVALDFDRVEKRLYWLDIENKVIERMFVNTTNRETVLKYNL
PGAESLAVDWVTRKLYWVDSYLNCLSVSDLNGRYRRKLAEHCVDANNTFCFENPRGLALH
PRYGHVYWADWGDRAYIGRVGMDGTLKSLIISTKIMWPNGLTIDYTNDLLYWADAHLGYI
EFSDLEGRHRHTVYETGTLSHPFAITIFEDTIYWTDWNTKTVEKGNKYNGSDRVALLNVT
HRPYDIRVYHPYRQPIVVPNPCGTNNGGCSHLCLIKEGGVGFTCECPDNFYTVQRGPNTQ
CLPMCSSTQFLCADSEMCIPIWWKCDGRRDCLDGSDEPITCPQRFCALGMFQCNDGNCTN
SHSLCNLRQDCPDGSDEDPVLCEHHQCEPYEWQCANKRCIPESWQCDMQDDCDDNSDEDS
SHCASRTCRPGYFKCANGHCIPQIWKCDVDNDCGDYSDEPLQECLGPSYRCDNYTEFSCK
TNYRCIPKWAVCNGVDDCRDNSDEQDCESMTCKPSGEFRCTNHRCIPLRWRCDGQNDCGD
RSDEENCAPRKCTESEFRCDDQSCIPSRWVCDQTNDCGDNSDERDCEMMTCRPGYFQCDS
GHCISEHMKCNGVADCRDASDEANCPTRFPNGAYCPATMFECKNHVCIHSSWKCDGDNDC
GDGSDEELHLCLNVACDSPYRFRCDNNRCIYRHEVCNQEDDCGDGSDEKKELCVEPTPRP
CTPDEFKCSNGRCIPQHRVCDHVNDCGDNFDETGCNTGKDRSCAENLCEHNCTQLREGGF
ICSCRPGFKPNSIDRNLCEDINECMQFGSCPQICHNTKGSYECSCAEGFTSLSDRYGERC
AADGSPPLLLLPENVRIRKYNLSSLQFSEYLEDQERIKAMDYDWDPEGTGLSVVYYTVLG
EGSNSGAIKRAYIPNFESGSNNPVMEINLDLKYIVQPDGLAVDWVGRHIYWSDARRQRIE
VAELDGRYRKWLISTELGQPAAIVVNPKLGFMYWTDWGENPKIESAWMDGQRRKVLVQED
LGWPTGLCIDYMNGDRIYWSDLKDNIVETIKYDGTDRRIVVTSAVNPYSLDIFESQLYWT
SKDKGEVWIQDKFGRNKKEKLLTVNPWLTQVRVFHQRKYNHSVPNRCKDVCSHLCLLRPK
GYTCACPQGSRFLEGSVTVCDAAIVGAVSMPPPCRCMNRGSCYFDENNLPKCKCSSGYVG
EYCEMGLSQGVPPGTTAASVLLTVILIVIIAALATLGFLHYRKTGSILPSLPKLSSLSHL
KSSENGNGVTFRSGDDVNMDIGVTGFGPESAIDRSLAMNEHFAADFGKSPIIFENPTYSS
KDTAITVAQPTTAPVTESATVYNKNYGSPINPAELVTDTKPTSSSDETQPTKWNIFKRKP
KQNTNFENPFYSEMENEPKVGAAVTPPPSPSPPAKVSWKKGSTPGYSATEDTFKDTANLV
REDSEA
Download sequence
Identical sequences F1N6H1
ENSBTAP00000005988 ENSBTAP00000005988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]