SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006011 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006011
Domain Number 1 Region: 63-183
Classification Level Classification E-value
Superfamily L domain-like 8.5e-30
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 247-517
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000051
Family Soluble quinoprotein glucose dehydrogenase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006011   Gene: ENSBTAG00000004578   Transcript: ENSBTAT00000006011
Sequence length 540
Comment pep:known_by_projection chromosome:UMD3.1:8:69964100:69970068:-1 gene:ENSBTAG00000004578 transcript:ENSBTAT00000006011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLQARRVSGLRLLALSTLGLCLMLQVGAKRPPKTPPCPPSCSCTRDTAFCVDSKAVPR
NLPSEVISLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIE
NNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILSDLDLRGNSLNCDCKVKW
LXSPGMLPVPCLASRVALTLLPNLTLTPPLIPADFVLYQTLSFPAVSAEPFLYSSDLYLA
LAQPGASACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDSQLYVVVAQLFGGSYIYHW
DPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWYFAVADSSKAGATSLYRWHQNGFYSHQ
ALHPWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQVPDAQAVKH
FRAGRDSYLCLSRYIGDSKILRWEGARFSEVQALPSRGSLALQPFLVGGRRYLALGSDFS
FTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA
Download sequence
Identical sequences E1BFY8
ENSBTAP00000006011 ENSBTAP00000006011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]