SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006018 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006018
Domain Number 1 Region: 157-352
Classification Level Classification E-value
Superfamily vWA-like 6.26e-55
Family Integrin A (or I) domain 0.00037
Further Details:      
 
Domain Number 2 Region: 834-1040
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.18e-25
Family Laminin G-like module 0.063
Further Details:      
 
Domain Number 3 Region: 369-540
Classification Level Classification E-value
Superfamily Fibronectin type III 2.29e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 643-814
Classification Level Classification E-value
Superfamily Fibronectin type III 1.64e-20
Family Fibronectin type III 0.00071
Further Details:      
 
Domain Number 5 Region: 552-638
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000846
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 32-102
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000116
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006018   Gene: ENSBTAG00000004582   Transcript: ENSBTAT00000006018
Sequence length 1277
Comment pep:known_by_projection chromosome:UMD3.1:13:54734579:54756417:-1 gene:ENSBTAG00000004582 transcript:ENSBTAT00000006018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVRPHLGVGLCLYLSVTLGLSQGQASGRLRLAVLPEDRLQMKWRESEGSSLGYLVQV
KPRAGDPEQEVMLTTKTPKATVGGLSPSKGYTLQIFELTGSGNILLARREFVIEDLKSNS
VSRSSQRPLGATLEPTPSLVGSPDLEPPGALAPSQDPPTLGRPQFRCTPPMPVDMIFLVD
GSWSIGHSHFQQVKDFLASVIEPFEIGPGKVQVGLTQYSGAPQTEWDLNAFGTKEEVLNA
VHNLHYRGGNTFTGLALTHVLEQNLKPRAGLRPEAAKLVILVTDGKSQDDAHTAGHVLKG
LGVDIFAVGVKNADETELRLLASQPLDITVHNVQDFPQLSTLSGLLSRLICQKVQGRSPR
GSPATPALDPPPAPTRLVLTQVTSSSVLLSWSPAPQPPLKYLIVWRPSKGGTPREVVVEG
PTSSAQLHNLTSSTEYLVSVFPLYKAGVGEGLQGLATTAPLPPPQALTLAAVTPKTVRLT
WQPSAEATQYLVRWSPASPKGEEERREVRVGRPEVLLDGLAPGRDYDVWVQSLRGAEISE
AQGIRARTPALTTPRHLSFSDVSHDSARVSWEGTARPVRLFRVSYISGKGGHSGQTEVPG
NATSAILGPLSSSTTYMVRVTCLYPGGSSSTLTSRLTTRKVPSPSQLSVTELPGDEVRLE
WAAAAVSGVLVYQITWMPLGEGKAREISVPGNLGTAILPGLGRHSEYEITILAYYRDGAR
SDPVSLRYTPVSRSPPSNLALASESPDSLRVSWTPPSSHVLHYRLSYALASGSGPEKSIS
IPGPGSHVTIPDLLAATKYRVLVSAIYGAGESVAVSATGRTAACPALHLDGSLPGFDLMA
AFGLVEKEYASIRGVAMEPSAFGPTRTFTLFKDSQLTRRASDIHLATLPPEHTVVFLLRL
LPETPREAFALWQVASEDFQPILGVLLDAGRKSLTYFNRDPRATLQEVTFDLPEVRRIFF
GSFHKVHVAVGRARVRLYVDCRKVAERPIGEAGGLPAAGFVMLGRLAKARGPRSSSASKF
QLQVLQLVCNDSWAEEDRCCELPASKEGESCPAFPSACACSSQTPGPPGPQGPPGLPGRN
GAPGEQGFPGPRGEPGPPGQMGPEGPGGQQGSPGTQGRTIQGPVGPPGVKGEKGDHGHPG
LQGHPGLQGTPGKIGIQGPKGMRGLEGTAGLPGPPGPRGFQGTSGARGSNGERGPPGAVG
PTGLPGPKGERGEKGEPQSLATIYQLVGQACESAIQTHVLKLHACTHESTRPPMPILEAP
RALGTSNKARLPGEGGH
Download sequence
Identical sequences E1BFY7
ENSBTAP00000006018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]