SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006074 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006074
Domain Number 1 Region: 527-742
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-105
Family Thrombospondin C-terminal domain 0.0000000879
Further Details:      
 
Domain Number 2 Region: 404-525
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.15e-34
Family TSP type-3 repeat 0.00000377
Further Details:      
 
Domain Number 3 Region: 28-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 6.41e-18
Family Assembly domain of cartilage oligomeric matrix protein 0.00012
Further Details:      
 
Domain Number 4 Region: 266-334
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000418
Family TSP type-3 repeat 0.00061
Further Details:      
 
Domain Number 5 Region: 172-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family EGF-type module 0.023
Further Details:      
 
Domain Number 7 Region: 377-406
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000183
Family TSP type-3 repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006074   Gene: ENSBTAG00000004630   Transcript: ENSBTAT00000006074
Sequence length 755
Comment pep:known chromosome:UMD3.1:7:4354380:4361950:1 gene:ENSBTAG00000004630 transcript:ENSBTAT00000006074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLAAARVLLLTLAALGASGQGQMPLGGDLGPQMLRELQETNAALQDVRDLLRQQVKEIT
FLKNTVMECDACGMQPARTPKLTVRPLSQCSPGFCFPGVACTETANGARCGPCPEGFTGN
GSHCADVNECTAHPCFPRVRCINTSPGFRCEACPPGFSGPTHEGVGLAFAKANKQVCTDI
NECETGQHNCVPNSVCVNTVGSFQCGPCQPGFVGDQASGCRRRPQRFCPDGTPSPCHEKA
DCVLKRDGRSCVCAVGWAGNGLICGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQED
VDQDGIGDACDPDADGDGVLNEKDNCPLVRGKEGRPSGGGKGGPCVRCCRGKRTEPYWEP
AKGGVGTLSQTNPRSARIRNPVDNCPKVPNSDQKDTDGDGVGDACDNCPQKSNADQRDVD
HDFVGDACDSDQDQDGDGHQDSKDNCPTVPNSAQQDSDHDGQGDACDDDDDNDGVPDSRD
NCRLVPNPGQEDMDRDGVGDACQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVILDTTMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYEAQRLLQA
Download sequence
Identical sequences F1MTZ9
ENSBTAP00000006074 ENSBTAP00000006074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]