SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006107 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006107
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily L domain-like 5.44e-35
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 2 Region: 224-341
Classification Level Classification E-value
Superfamily Hormone receptor domain 9.16e-17
Family Hormone receptor domain 0.0053
Further Details:      
 
Domain Number 3 Region: 154-257
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000274
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006107   Gene: ENSBTAG00000004653   Transcript: ENSBTAT00000006107
Sequence length 1235
Comment pep:known_by_projection chromosome:UMD3.1:6:43436544:43531420:-1 gene:ENSBTAG00000004653 transcript:ENSBTAT00000006107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTNNRIGCLNA
DIFRGLTNLVRLNLSGNLFSSLSQGTFDYLGSLRSLEFQTEYLLCDCNILWMHRWVKERN
ITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMA
SYIDQDMQVLWYQDGRIVETDESQGIFVEKNMIHNCSLIASALTISNIQAGSTGNWGCHV
QTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGDFRWPRTLAGITAYLQCTRNAHGSGIY
PGNAQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLA
YTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLADERVLGLAQR
EAKACSRIVQCLQRIATYRLANGAHVYSTYSPNIALEAYVIKATGFTGMTCTVFQKVAAT
DRTGLSDYGRRDLDGNLDKQLSFKCNVSNTFSSLALKNTIVEASIQLPPSLFSPKQKREV
RPSDDSLYKLQLIAFRNGKLFPATGNSTNLADDGKRRTVVTPVILTKIDGVNIDTHHIPV
NVTLRRIAHGADAVAAQWDFDLLNGQGGWKSDGCHILYSDENITTIQCYSLSNYAVLMDL
TGSEFYTQAAHLLHPVVYTTAVILLLCLLAVIVSYIYHHSLIRISLKGWHMLVNLCFHIF
LTCVVFVGGISQTRNASVCQAVGIILHYSTLATVLWVGVTARNIYKQVTKKAKRCQDPDE
LPPPPRPMLRFYLIGGGIPVIVCGITAAANIKNYGSRPNAPYCWMAWEPSLGAFYGPASF
ITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAANENGEVNHQDSMSQSLISTSAL
GNEHTFHAQLLGASLTLLLYVGLWMFGALAVSLYYPLDLVFSFFFGATCLSLSAFIVVHH
CVNREDVRLAWIMTCCPGRSTYSVQVNVQPPSSSGPSGEAPKCTNSSAESSCTNKSASSF
KNSSQGCKLTNLQAAAAQCHTNSLPLNATPQLDNSLTEHSMDNDIKMHVAPLEVPFRTNM
HPSRHHKNRSKGHRASRLTVLREYAYDVPTSVEGSVQNGLPKSRLGSNEGHSRSRRAYLA
YRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTSSKKDAVRKPTVVELESQQKSYGLNLA
IQNGPIKSSGQEGPLLGTDSTGNVRTGLWKHETTV
Download sequence
Identical sequences F1MK80
ENSBTAP00000006107 ENSBTAP00000006107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]