SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006219 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006219
Domain Number 1 Region: 43-245
Classification Level Classification E-value
Superfamily L domain-like 4.42e-37
Family Ngr ectodomain-like 0.045
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000006219
Domain Number - Region: 437-491
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0262
Family B3/B4 domain of PheRS, PheT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006219   Gene: ENSBTAG00000004738   Transcript: ENSBTAT00000006219
Sequence length 581
Comment pep:known chromosome:UMD3.1:16:50540189:50551301:1 gene:ENSBTAG00000004738 transcript:ENSBTAT00000006219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAVSEAWPELDLAERERRRELLLTGPGLEERVRAAGGRLPPRLFTLPLLHYLEVSG
CGSLREPGPGLAQGLPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALEALPPGQG
LGPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQTLNLTGNRLDAFPAALFLPGALP
LLSELAAADNCLRELSPDIAHLASLKTLDLSNNQLSEIPAELADCPKLKDINFRGNRLRD
KRLEKMVSGCQTRSILEYLRAGGRGRCRGKAEGPDKEEGRRKRRERKKRESGEGADAVVD
EASRLLLRVLHVSENPFLLTVRASPEVRDVRPFFVGAVVRGMDLRPGNALKRFLSCQTKL
HEDLCEKRTVATIATHDLGAVRGPLLYAARPPQDFKIIPLGRREVKAKDLVRQLQLEAEE
HRKQKKRQNVSGLHRYLHLLDGKEHYPCLVDADGDVISFPPITNSEKTKIKKTTSDLFLE
VTSAASLQICKDIMDALILKMAEINKYTLENREESSLSDPESDAVCGHGLDPKATPGAEV
TGSTPLVVEQVRVVDEEGHLKVVYPSKMDLDFAAAHVTVLR
Download sequence
Identical sequences A6QR01
ENSBTAP00000006219 ENSBTAP00000006219 NP_001095768.1.59421 NP_001095768.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]