SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006244 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006244
Domain Number 1 Region: 404-471
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 545-673
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 670-796
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-17
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 4 Region: 1177-1239
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 5 Region: 1341-1404
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.93e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 6 Region: 879-1001
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000149
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 799-921
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000011
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 357-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 9 Region: 1044-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000093
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 1289-1334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1572-1621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000202
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 12 Region: 288-353
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000576
Family TB module/8-cys domain 0.0026
Further Details:      
 
Domain Number 13 Region: 999-1051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000297
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 14 Region: 157-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000031
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006244   Gene: ENSBTAG00000004757   Transcript: ENSBTAT00000006244
Sequence length 1627
Comment pep:known_by_projection chromosome:UMD3.1:18:50173268:50202104:1 gene:ENSBTAG00000004757 transcript:ENSBTAT00000006244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPGPSGRRPLLLVLLLPLLAAAATAASAAGPSTSQAVEVAAIPGRPAGAPACRCCPSR
SPRRSRCFRASCRVRSCRPEKCAGLQRCLAPGPPELQSASPSVRKRQVSLNWQPLTLQEA
RALLRRRRPRGPGARALLRRRPPQRAPAGQSRVLCPLICHNGGVCVKPDRCLCPPDFAGK
FCQLHSSGARPPAPAMPGFTRSVYTMPLANHRDDEHGVASMVSVHVEHPQEASVVVHQVE
RVSGPWEEADAEAVARAEAAARSEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGGEC
ASPLPGLRTQEVCCRGAGLAWGVHDCQSCSELLGNTHQGGAPDGPCPTGFERVNGSCEDV
DECATRGRCQHGECANTHGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGC
SLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPGYHYSASDLRYNTRP
LGQEPPRVSLSQPRAPPSTSRPPSGFLPTHRPEPRPEPRPGPELPLPSIPAWTGPGIPES
GPSAGECQRNPQVCGRGRCIPRPSGYTCACDSGFRLSPQGTHCIDVDECRRVPTPCAPGR
CENTPGSFRCVCGPGFRAGPRGTECLDVDECHRVPPPCDRGRCENTPGSFLCVCPAGYQA
APHGASCQDVDECIQSPGLCGRGVCENLPGSFRCVCPAGFRGSACEEDVDECAQEPPPCG
PGRCDNTVGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCAYGRCENTEGGFQCVCPTG
FQPNAAGSECEDVDECENHLACPGQECVNSPGSFQCRACPAGHHLHHGRCTDVDECSSGA
SCGPHGHCTNTEGSFHCSCEPGYRAPVGRPGPCADVNECLEGDFCFPHGECLNTDGSFAC
TCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCLDID
ECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDIDECQEYGPAICGAQRCE
NTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEGA
RDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCVSPRTSAGTFP
GAQPHAPASPSLPARPPPPPPPRRPSPPRQGPVSSGRRECYFDTAAPDACDNILARNVTW
QECCCTVGEGWGSGCRIQQCPSTETAEYQSLCPHGRGYLAPSGDLSLRRVPDPALQPHTP
LPRSSPSHNLALPHLCKRGGGYFINHSLHASLDNDECADEEPACEGGRCVNTIGSYHCTC
EPPLVLDGSRRRCVSNESQSLDDNLGVCWQEVGADLVCSRPRLDRQATYTECCCLYGEAW
GMDCALCPAQDSDDFEALCNVLRPPAYGPPRPGGFGLPYEYGPDLGPPYQGLPYGPELYP
PPVLPYDPYPPPPGPFARREAPYGTPPFDMPDFEDDGGPYGESEAPAPSGPGTRWRYRSR
DTRGSFPEPEESPEGGSYAGSSGRPAKRLGRGTEKNSCSGMGHACSRGQVVRTPRARTSI
CNDTSLRTSWASIISIDINECDEAEAAAPLCVNARCVNTDGSFRCICRPGFAPSHEPHHC
TPARPRA
Download sequence
Identical sequences E1BA44
ENSBTAP00000006244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]