SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006358 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006358
Domain Number 1 Region: 431-687
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.62e-72
Family Eukaryotic proteases 0.0000000534
Further Details:      
 
Domain Number 2 Region: 25-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-30
Family Spermadhesin, CUB domain 0.0000014
Further Details:      
 
Domain Number 3 Region: 180-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-23
Family Spermadhesin, CUB domain 0.0000856
Further Details:      
 
Domain Number 4 Region: 365-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000751
Family Complement control module/SCR domain 0.0000728
Further Details:      
 
Domain Number 5 Region: 305-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000417
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 133-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family EGF-type module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006358   Gene: ENSBTAG00000004840   Transcript: ENSBTAT00000006358
Sequence length 695
Comment pep:known chromosome:UMD3.1:5:103768066:103779250:-1 gene:ENSBTAG00000004840 transcript:ENSBTAT00000006358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLPEMWCIVLFSLVAWVYAEPTMYGEILSPNYPQVYPNEVEKSWDIEVPAGYGIHLYF
THLDIELSENCSYDSVQIMSGGHEEGKLCGRRTNKNSNSPVVKEFHIPYSKLQVIFRSDF
SNEERFTGFAAYYVAEDIDECTAFADAPCSHFCNNFLGGYFCSCPPEYFLHEDKKNCGVN
CSGNVFTTMTGEVESPNYPSPYPESSRCDYQIQLEEGFRVVVTMRREDFDVEPADSEGHC
PDSLLFVAGDQHFGPYCGNGFPGPLTIETQSSALNIIFQTDGSEQRKGWKFRYHGDPIPC
PKEVTANSFWEPERAKYVFRDVVKITCVDGFEVVQGSVGSPSFYSTCQSNGKWSNSKLRC
QPVDCGAPEPIQHGRVEDPESTLFGSITRYSCEMPYYSMEYEGSEVYHCSGNGSWVNKVL
GIEPPKCIAVCGTPSEPFRSTQRIFGGSIAKIENFPWQVFFSNPWAGGALIDEYWVLTAA
HVVEGNDIPVMYVGSSSVVTSQLSNAQMLTAERVFIHPGWEVLDPSITRKNFDNDIALVR
LRDPVKMGPKVAPICLPGTSSEYDPPENVLGLISGWGRTNVKSHVIKLRGAKLPVAPLSK
CREMKGVNPGIDISSFVFTENMICAGNDKGVDSCDGDSGGAFAVQDPKENKPKFYVAGLV
SWGPQCGTYGIYTRVKNYVDWIRKTMQEYSAPSVD
Download sequence
Identical sequences F1MJ12
9913.ENSBTAP00000006358 ENSBTAP00000006358 ENSBTAP00000006358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]