SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006361 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006361
Domain Number 1 Region: 316-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-29
Family SPRY domain 0.068
Further Details:      
 
Domain Number 2 Region: 155-326
Classification Level Classification E-value
Superfamily ARM repeat 0.000000177
Family HspBP1 domain 0.071
Further Details:      
 
Domain Number 3 Region: 517-568
Classification Level Classification E-value
Superfamily RING/U-box 0.00000109
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006361   Gene: ENSBTAG00000004842   Transcript: ENSBTAT00000006361
Sequence length 576
Comment pep:known chromosome:UMD3.1:18:25295242:25332388:1 gene:ENSBTAG00000004842 transcript:ENSBTAT00000006361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFGWAVFLASRSLGQGLLLTLEEHIARFLGTRSATATMGNSCICRDDSGAEDSVDTQQ
QQADNSAVPTADMRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTE
ILNLNGEVACQDSGHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTSENKLTISESSISDRLVTLESWTDDPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVDLNSIKAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDAGV
WYYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHLHP
CWKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGA
KPFKYPPSMKFSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLK
PCGHSDLCMDCALQLETCPLCRKEIVTRVRQISHIS
Download sequence
Identical sequences A4IFG8
ENSBTAP00000006361 9913.ENSBTAP00000006361 NP_001077203.1.59421 NP_001077203.1.76553 XP_010860198.1.44457 XP_015331251.1.76553 XP_019835296.1.53367 XP_019835297.1.53367 ENSBTAP00000006361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]