SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006460 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006460
Domain Number 1 Region: 23-274
Classification Level Classification E-value
Superfamily L domain-like 2.34e-47
Family Ngr ectodomain-like 0.000000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006460   Gene: ENSBTAG00000004909   Transcript: ENSBTAT00000006460
Sequence length 650
Comment pep:known_by_projection chromosome:UMD3.1:19:27094265:27096217:-1 gene:ENSBTAG00000004909 transcript:ENSBTAT00000006460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLLLLLLLPSPSHPVPICEVGNKDSQVEVNCENKGLKAPPPDLPADTAILHLGENPLG
TFSMASVLNLSQLTELFLGKSQLTSLQADAKLPRLEVLNLAHNKLRSLPKLGRALPVLSI
LDVSFNELTSLPSDTLHGLSRLQELYLRGNQLRTLPPELLVPTPHLKKLSLAENDLQELP
PELLKGLEELDTLYLQKNRLRTIPTDFFGMLLLPYAFFHNNSWSCDCGILYFSRWLQDNP
SNVYVWEEDVDIKAMTPDVKSVRCVNMNGMYVYNFLGDSCNIPGDRDNLDYDEYEDKDEQ
EVSVVNTVSSLSSHTTHWDLLYLTSPTSPGSQVSSLPPVKKLTTTPITIDSITSSKTLNP
TTEPPTTPTTPESTTPTTPEPTIPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPTTPTTPE
PTTPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPTTPTTLEPTTPTTPEPISE
TLQPTIFLTSTESISLPTILESTITIISESDNPWKVQGLASSSNNPVLSSDSCCLFLGFY
ILGLLWLLVASVILILLLCWVQQVKPWALATATHTAHLELQRGRQVMVHRAWLLFFQGLL
PTFRSSLFLWVRPNGRMGPLQAGRRPSALSLGRGGDLLGTVGVRYSGHSL
Download sequence
Identical sequences E1BB32
XP_015314139.1.76553 XP_015323495.1.59421 ENSBTAP00000006460 ENSBTAP00000006460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]