SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006480 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006480
Domain Number 1 Region: 162-333
Classification Level Classification E-value
Superfamily L domain-like 3e-31
Family Ngr ectodomain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006480   Gene: ENSBTAG00000004926   Transcript: ENSBTAT00000006480
Sequence length 424
Comment pep:known chromosome:UMD3.1:10:42685930:42696776:1 gene:ENSBTAG00000004926 transcript:ENSBTAT00000006480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLHCEVEVVSRHLPALGLRNRGKGVRAVLSLCQQAPRTPPGPRAGGERGGRHPACLFIS
TLKDKRGTRYELKENIEQFFTKFVDEGKATVRLKEPPVDICLSKANSSSLKGFLSAVRLA
HRGCDVEAPLSTLTPVKTSEFEKFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRVD
MRMLCLKNLRKLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCQSTLQKSLQS
LDISKNKIKALPVQFCQLRELTYLKLDDNELIRLPFKMGQLRNLRFLSAARNKLPFLPSE
FKNLSLEYLDLFGNTFEQPKVLPVIHLQMPLTLLESSARTILYNRIPYGSRIIPFHLCQD
LDTAKTCVCGRYSISSFIQGTTTMNLHSVAHTVVLVDNMGGTEAPIISYFCSLACYVNSC
DMLK
Download sequence
Identical sequences A6QPV4
ENSBTAP00000006480 9913.ENSBTAP00000006480 NP_001098495.1.59421 NP_001098495.1.76553 ENSBTAP00000006480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]