SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006673 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006673
Domain Number 1 Region: 49-187
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 8.36e-29
Family 4HBT-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006673   Gene: ENSBTAG00000005063   Transcript: ENSBTAT00000006673
Sequence length 208
Comment pep:known chromosome:UMD3.1:14:2839180:2842655:-1 gene:ENSBTAG00000005063 transcript:ENSBTAT00000006673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLELLVALLALALAYFALLDGWYLVRVPCAVLRARLLQPRVRDLLAEQSYAGRVLPSDLD
LLLHMNNARYLREADVARIAHLTRCGVLEALRALGARAVLAASCARYRRSLRLFEPFEVR
TRLLGWDDRAFYVEARFISLRDGFVCALLRSRQHVLGTSPERVVQHLCKRRVEPPELPAD
LQHWIAYNEASSQLLRAESGLHDILKEQ
Download sequence
Identical sequences A6H707 L8IHN9
ENSBTAP00000006673 ENSBTAP00000006673 NP_001092845.1.59421 NP_001092845.1.76553 XP_005897670.1.15283 9913.ENSBTAP00000006673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]