SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006728 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006728
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000884
Family Ngr ectodomain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006728   Gene: ENSBTAG00000005106   Transcript: ENSBTAT00000006728
Sequence length 418
Comment pep:known chromosome:UMD3.1:26:15126483:15134920:1 gene:ENSBTAG00000005106 transcript:ENSBTAT00000006728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLHWSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLSHTNATVEDIY
CEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYMNDEYVVIAQPFTGK
CIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFI
KIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRD
TDVEYLEIARTPQTLRTPHLILSSSSQRPVIYQWNKAIQLFTNQTDIPNMEDVYAVKHFS
VKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFT
QVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA
Download sequence
Identical sequences G3X6H4
ENSBTAP00000006728 ENSBTAP00000006728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]