SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006786 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006786
Domain Number 1 Region: 259-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-32
Family Pentraxin (pentaxin) 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006786   Gene: ENSBTAG00000005148   Transcript: ENSBTAT00000006786
Sequence length 468
Comment pep:novel chromosome:UMD3.1:25:1159757:1163098:-1 gene:ENSBTAG00000005148 transcript:ENSBTAT00000006786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPTGRALPFFLILVHIYLHGALSQTTGPVGQRKPFFERLRRLEEQFRRFQEVTLTHLQ
GIASHYNLSFDIEARFQSLAHESRAVALALNQSQAAVQDKLGHLRTWVRRTQRRGRKADH
RLLALSAAMSEGSARRAREQERQRAAVSGLARDVRALQDALLRLTPLVQSQSTRLAALEG
QLRLAGPSPAARNVTPDPSRPSNPSAPQLQGGGQMIRAPPEPRDPPLDFAYRLQGAQEPL
GLGNQQAWPPESPGEVCNVGPALIFPNASTMNVGFLRPGFLTGLRALSICSWVRTAADHL
GTLLSYATEENDNKLVLHGRDSLAPGSVHFVIGDPAFRELPLQPLLDGQWHHVCVIWTSI
LGRYWLHVDRRLVATGSRFREGYEIPPGGSLVLGQEQDHVGGGFDSSEAFVGSMAGLAIW
DRVLVPGEISNLAMGKALPTGAILTLDNATSVGGFVQRVNCTCLQLCP
Download sequence
Identical sequences E1B8G2
ENSBTAP00000006786 ENSBTAP00000006786 XP_002698022.1.76553 XP_602381.5.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]