SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006790 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006790
Domain Number 1 Region: 11-253
Classification Level Classification E-value
Superfamily Aquaporin-like 1.57e-54
Family Aquaporin-like 0.0000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006790   Gene: ENSBTAG00000005149   Transcript: ENSBTAT00000006790
Sequence length 288
Comment pep:known_by_projection chromosome:UMD3.1:3:16291805:16294625:-1 gene:ENSBTAG00000005149 transcript:ENSBTAT00000006790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLRIRSLLARQCLAELLAVFVLMLLIQGSSAQAVTSGGTKGNFFTVFLAGSLGIMLAI
YVSGNVSGAHLNPAFSLPMCLRGHLPWARFLSYSLVQLLSAFCASGVPYALYHALQNYPG
GSLTVTGPKETASIFATYPAPYLSLSNGFLDQVLGTWKLMVGMAILDRNKGVPAGLEPVV
VGLLILADMLSMGANCGFPINPVQDLDPRLFTYVAGWGPEVFSAGNGWWWVPVVGSLVGA
MPGTATYQLLVAKHHPEDSEPSQDLECAQQEASDSGSPAATQLQESKL
Download sequence
Identical sequences F1MNJ1
ENSBTAP00000006790 ENSBTAP00000006790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]