SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006913 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006913
Domain Number 1 Region: 295-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-45
Family SPRY domain 0.0000923
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RING/U-box 1.94e-26
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 3 Region: 88-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006913   Gene: ENSBTAG00000005251   Transcript: ENSBTAT00000006913
Sequence length 497
Comment pep:novel chromosome:UMD3.1:15:48506850:48521081:-1 gene:ENSBTAG00000005251 transcript:ENSBTAT00000006913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEKLVSLQDEVTCPICLELLTEPLSLDCGHSFCQICITANSNESLTGQERARKCPVCR
INYKSGKLRPNWHLANIVQRVREVKLSLEEQEKHLCAHHGEKLLLFCEEDGKVICWLCER
SQEHHGHPTFLMEEVAQEYQKKLQAALERLKQEQQEAEELESDFREEIAAWKNQTQHERQ
NVQAEFKKLREILDSEERKELQKLKAEETAILCTMANSENELVQQSQLVRNLISDIEHRL
QGSTMQMLQDVNDILKSPRSKTLTLKKPKPVPKEQRSVFRAPDLRDILRVFNGLRYVQRY
WVHVTLSHTTGNRNIAISADRRQVTYVYKDQGNNPRWKQVYEDYGVLGSPVIKSGRHYWE
VDVSKKRAWILGVYGEKHVEYNTKLPLKADGNHQNVYSRCQPKNGYWVIGLSYGSVYNAF
DESSSSDPMILTLSLSVPPHRIGIFLDYSARTLLFLNVTNHGFLIYKFSSCSFSQKIFPY
FNPMTCNVPMNLCSPSS
Download sequence
Identical sequences E1BM69
ENSBTAP00000006913 ENSBTAP00000006913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]