SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006924 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006924
Domain Number 1 Region: 1247-1307
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000621
Family BSTI 0.036
Further Details:      
 
Domain Number 2 Region: 46-106
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000213
Family ATI-like 0.053
Further Details:      
 
Domain Number 3 Region: 442-502
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000036
Family ATI-like 0.043
Further Details:      
 
Domain Number 4 Region: 1629-1689
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000474
Family ATI-like 0.022
Further Details:      
 
Domain Number 5 Region: 864-919
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000016
Family ATI-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006924   Gene: ENSBTAG00000005261   Transcript: ENSBTAT00000006924
Sequence length 1917
Comment pep:known_by_projection chromosome:UMD3.1:18:49726103:49751466:-1 gene:ENSBTAG00000005261 transcript:ENSBTAT00000006924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVRDCVYDRCLLPGQSGPLCDALAAYADACQAAGLTVHPWRSEELCPLSCPSHSHYEEC
SYGCPLSCGDLPVSGGCGFECKEGCVCDEGFVLNGESCVPLASCGCVYQGSYYPPEQTFY
PGPECDSLCYCEEGGLVSCVPSSCGPHEACQPSNGVLGCVAVGSTTCQASGDPHYTTFDG
QRFDFMGTCVYVLAQTCGTRPGLPQFAVLQENVAWGNGKVSVTKAITVQVANFTLRLEQN
QWKVTVNGVDRRLPVLLDEGRIHVFQHGSDVVIETDFGLRVAYDLVYNVRVTVPGNYYQQ
LCGLCGNYNGNPKDDFQKPDGSQAGSANEFGNSWEEAVPDSPCLPPPTCQPGDKDCDTEL
ECKPELQNKYEQQEFCGLLTSPTGPLAACHKLLDPQGPLQDCVFDLCVGGGNESILCSNI
HAYVSACQAAGGHVEPWRTESFCPMQCPPNSHYEVCADTCSLGCSALSAPPQCPERCAEG
CQCDSGFLSDGQGCVPIQECGCYHNGIYYEPEKVVLTDNCQQQCVCQPGKGLVCQNHSCS
DGQVCQPSGGVLSCVTKDPCHSVTCRPQETCQNKNGQGVCVPNYQATCWLWGDPHYHSFD
GWNFDFQGTCNYVLASTDCPGSNAQGLTPFTVTTKNENRGNPSVSYVRLVTVTTLNTNIS
IHKGEIGKVRVNGVLRALPVSVADGRLLVTHGASKAVLATDFGLQVTYDWDWRVEVTLPS
SYHSAICGLCGNMDRNPSNDQAFPNGTLAPSIPIWGGSWRVPGWDPLCWDECQGSCPTCA
EDRLEEYGGPGFCGPLAPGSGGPFAACHDHVAPDSFFKGCVLDVCLGGGAKDILCQALAA
YAAACQAAGIVIKDWRTEAGCELPCPENSHYELCGPPCPASCPSPTPPTSPAVCEGPCVE
GCQCNSGFVLSADRCVPLEGGCGCWANGIYHEAGSEFWADATCSQRCQCGPRGGSLVCKP
ASCRLGEECALLPSGQHGCQPVSTAECQAWGDPHYITLDGHRFDFQGACEYLLSAPCHDL
PEGALNFTVTVANEHRGSQAVSYTRTVTLHIYGHSFTLSAGWPRQLQVDGKLVALPFQLD
SRVHAYLSGADVVVTTASGISLAFDGNSNVRLRVPAAYAGALCGLCGNYNKNPNDDLNAV
EGNPDRWQVGGAAGCGECVPGPCPKPCTPEQQEPFGGPDACGVISSLEGPLAPCHSLIPP
EQYFQACLLDACQAQGHPGGLCPAVAAYVAACQAAGAQLGEWRRPDFCPFQCPAHSHYQL
CGDSCPVSCPSLSAPEGCESTCREGCVCDAGFVLSGDTCVPVGQCGCLHEGRYYPLGETF
YPGPECGRHCQCGPGGQVSCQEGETCRPYEECRVQDGVQACRPTGCGRCLANGGVHYITL
DGRVYDLHGSCSYILAQVCHPQPGDEDFTIVLEKNAAGDPQRVVVTVAGQVVTLARGPQV
TVDGEAVALPVAVGHVRVTAEGRNIVLQTTKDLRLLFDGDAHILISIPSPFRNRLCGLCG
NFNGNWNDDLDLPSGTTAPSVDAFGAAWRAPGSSQGCSEGCGPQGCPVCSAEQTAPYESL
EACGQLRDANGPFSACHAALSPSEYFRQCVYDLCAQKGNVTYLCRSLAAYTAACQAAGMA
VKPWRTDSFCPLQCPTNSHYSVCTRSCQGSCAALSGLTGCTTRCFEGCECDDRFLLSQGV
CIPVQDCGCTHDGRYLPVNSSLLTSDCSQRCSCSSSTGLTCQAASCPLGRVCEVQAGTRD
CWVPHGLCSLSVGANLTTFDGAHSAVSSPGVYEISFRCPGSQETVPWYRVVADVQPCKGK
VEAVARVHIFFQDGLVTVTQNKGVWVNGLQVDLPAEVLTSVSVSQNPDGSVLVQQKEGVQ
VKLGADGQLAVVVSDDHAGKLCGACGNFDADWSNDWPNSQETTLENWKAQDFSPCPS
Download sequence
Identical sequences G3X6I0
ENSBTAP00000006924 ENSBTAP00000006924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]