SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000006988 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000006988
Domain Number 1 Region: 625-924
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-80
Family Protein kinases, catalytic subunit 0.000000000355
Further Details:      
 
Domain Number 2 Region: 38-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-72
Family Ephrin receptor ligand binding domain 0.000000224
Further Details:      
 
Domain Number 3 Region: 337-542
Classification Level Classification E-value
Superfamily Fibronectin type III 5.96e-40
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 921-994
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.35e-21
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000006988   Gene: ENSBTAG00000005313   Transcript: ENSBTAT00000006988
Sequence length 997
Comment pep:known chromosome:UMD3.1:1:83202439:83244544:-1 gene:ENSBTAG00000005313 transcript:ENSBTAT00000006988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARPPPLPPLPPGLLPLLSPLLLLPLLLPAGCRALEETLMDTKWVTSELAWTSHPESG
WEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPN
IPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSF
GPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGTC
IANAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPC
LPCPPNSRTTSPAAGICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSE
PRDLGGRDDLLYNVICKKCHGGPGTMTCSRCDDNVEFVPRQLGLTERRVHVSHLLAHTRY
TFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNG
VILDYEMKYFEKSEGIASTVTSQKNSVQLDGLRPDARYVVQVRARTVAGYGQYSHPAEFE
TTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAVVCLRKQRHSSDSEYTEKLQQYI
APGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVF
VAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDS
FLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSR
FLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWD
MSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAAS
LKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMT
AEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences F1ML02
NP_001179725.1.59421 NP_001179725.1.76553 ENSBTAP00000006988 ENSBTAP00000006988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]