SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007052 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007052
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.03e-76
Family Phosphate binding protein-like 0.00000363
Further Details:      
 
Domain Number 2 Region: 239-297,331-353
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.05e-18
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007052   Gene: ENSBTAG00000005364   Transcript: ENSBTAT00000007052
Sequence length 361
Comment pep:known chromosome:UMD3.1:15:30194980:30202275:1 gene:ENSBTAG00000005364 transcript:ENSBTAT00000007052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNAAAIAEEDTPKMRVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELEHALERNEVDLVVHSLKDLPTVLPPGFTIGAVCKRESPY
DAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLDEL
QEFSAIILATAGLQRMGWQNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHD
PETLLRCIAERSFLRHLEGGCSVPVAVHTAIKDGQLYLTGGVWSLNGAETMQDTMQTTIH
VPVQHEDGPEDDPQLVGITARNIPRQPQLAAENLGISLATLLLNKGAKNILDVARQLNEA
H
Download sequence
Identical sequences Q2KIN5
ENSBTAP00000007052 ENSBTAP00000007052 NP_001039672.1.59421 NP_001039672.1.76553 9913.ENSBTAP00000007052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]