SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007349 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007349
Domain Number 1 Region: 180-270
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.35e-23
Family Thyroglobulin type-1 domain 0.00024
Further Details:      
 
Domain Number 2 Region: 54-94
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000011
Family Growth factor receptor domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007349   Gene: ENSBTAG00000005596   Transcript: ENSBTAT00000007349
Sequence length 285
Comment pep:known chromosome:UMD3.1:2:105338358:105367369:1 gene:ENSBTAG00000005596 transcript:ENSBTAT00000007349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRLGGPALLLLPPLLLLLLLGAGGGDCGARAEVLFRCPPCTPESLAACKPPPGXRCGV
YTPRCGQGLRCYPNPGSELPLRALVHGEGTCEKHGDAEYSASPEQVADNGEEHSEGGLVE
NHVDGNVNLMGGGGGAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRP
PPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQR
GECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQGARGVHTQRMQ
Download sequence
Identical sequences F1N2P8
ENSBTAP00000007349 ENSBTAP00000007349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]