SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007366 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007366
Domain Number 1 Region: 292-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-46
Family SPRY domain 0.0000507
Further Details:      
 
Domain Number 2 Region: 4-86
Classification Level Classification E-value
Superfamily RING/U-box 6.36e-23
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 86-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000427
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007366   Gene: ENSBTAG00000037465   Transcript: ENSBTAT00000007366
Sequence length 488
Comment pep:known chromosome:UMD3.1:15:48531198:48545435:-1 gene:ENSBTAG00000037465 transcript:ENSBTAT00000007366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNTVMNLQEEVSCPICRELLTEPLSLGCGHSFCQTCITNKETDISLGGDSSCPVCGTQ
YSLGNLWPNLHLANIVERLRKVKLSPEEGQKTGLCVHHEEKLLLFCKEDRKVICRLCERS
QEHHGHHTFLMEEALKESQEMLQAALTRLRKEQQKAEKLEADIREERTSWKYQIQTERQR
IQTEFNQLRSILDSEEQRELQKLEEEEKKTLDSLAVAEAELVQQGELLKELISDLERRSE
WSTVELLQDMSGIMKWSEIWTLKKPKTVSKKLKNVFRVPDLLGMLHTFKDLTRVQCHWVD
ITLNPFNLNLNLVLSEDQRQVLSVPIWPVKYYNYGILGCQYFSSGKHYWEIDVSEKNAWI
LGVYCRIRSCNIKFAVQQSTSYENAYSIYRPQFGYWVIGLKDKFRYEAFEDSSTTHPDSR
VLTLSMTVPPRHVGVFLDYEAGTVSFFNVTNHGSLIYKFSKCNFSRNAYPYFNPWDCPAP
MTLCPPSS
Download sequence
Identical sequences F1N2E6
9913.ENSBTAP00000007366 ENSBTAP00000007366 XP_005216197.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]