SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007623 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007623
Domain Number 1 Region: 287-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-51
Family SPRY domain 0.0000867
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 1.68e-18
Family RING finger domain, C3HC4 0.0099
Further Details:      
 
Domain Number 3 Region: 82-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.39e-16
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007623   Gene: ENSBTAG00000005798   Transcript: ENSBTAT00000007623
Sequence length 487
Comment pep:known chromosome:UMD3.1:25:34320559:34327971:1 gene:ENSBTAG00000005798 transcript:ENSBTAT00000007623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQVSVPELEDRLQCPMCLEVFKEPLMLQCGHSYCKGCLVSLSHHLASELRCPVCRQEV
DYSSSPPNVSLAKVIEALRLPGDPEPQVCAHHRNPLSLFCEKDQELICGLCGLLGAHQHH
RVTPVSTVYSRMKEELAALISDLKQEQKKVDEQIAKLVNNRTRIVNESDVFSWVIRREFQ
ELHHLVDEEKARCLEGVEGHTRGLVASLDMQLEQARGAQERLVQATGVLEQFGSESHHEF
IRKYHAMASRPELQQARLSEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPESLKLDP
ATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLTSRGFSCGRHYWEVVVGSKSD
WRLGVIKGTASRKGKLSKSPEHGVWLIGLKEGRVYEAFGCPRVPLPVAGHPHRIGIYLHY
EQGELTFFDADRPDDLRPLYSFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGHLS
PLQPTKL
Download sequence
Identical sequences E1BNQ6
ENSBTAP00000007623 NP_001193185.1.59421 NP_001193185.1.76553 9913.ENSBTAP00000007623 ENSBTAP00000007623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]