SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007628 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007628
Domain Number 1 Region: 338-452,572-718
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.72e-63
Family Phosphate binding protein-like 0.00000000208
Further Details:      
 
Domain Number 2 Region: 5-319
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.78e-49
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 3 Region: 468-571
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000204
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007628   Gene: ENSBTAG00000005800   Transcript: ENSBTAT00000007628
Sequence length 837
Comment pep:known_by_projection chromosome:UMD3.1:7:66766525:67109288:1 gene:ENSBTAG00000005800 transcript:ENSBTAT00000007628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPEL
QDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLF
QDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGAN
VTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQNLRR
QRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVI
EMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQF
EGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVA
VAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIG
VSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRS
LSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGST
KEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQR
KPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGS
GGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQS
INEAIRTSTLPRNSGAGASGAGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
Download sequence
Identical sequences F1N3G8
ENSBTAP00000007628 ENSBTAP00000007628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]