SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007690 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007690
Domain Number 1 Region: 174-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000232
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 2 Region: 213-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000224
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 134-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000298
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 95-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000125
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000007690
Domain Number - Region: 64-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00534
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007690   Gene: ENSBTAG00000005850   Transcript: ENSBTAT00000007690
Sequence length 383
Comment pep:known chromosome:UMD3.1:23:16981806:16986060:-1 gene:ENSBTAG00000005850 transcript:ENSBTAT00000007690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGCRCLHLVCLLCILGAPVKPARGNDCSSLCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHTGWAGKFCDKDEHICTTQSPCRNGGQCVYDGGGDYHCVCP
PGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLAGFMGARCEVNVDDCLM
RPCANGATCLDGINRFSCLCPEGFTGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPS
GYGGKTCELVLPVPGPAATADSPPGPTLAVLVPATGPIPHSAGAGLLRISVKEVVRRQEA
GLGEPSLVAVVVFGAVTAALVLSTVLLTLRAWRRGFCPPGPCCYPAPHYAPARQDQECQV
SMLPTGLPLPPDLPPEPGKTTAL
Download sequence
Identical sequences A4FV93
ENSBTAP00000007690 ENSBTAP00000007690 NP_001076963.1.59421 NP_001076963.1.76553 XP_005223540.1.76553 XP_005223541.1.76553 XP_005223542.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]