SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007756 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007756
Domain Number 1 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-56
Family YWTD domain 0.00000555
Further Details:      
 
Domain Number 2 Region: 29-289
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-54
Family YWTD domain 0.00000175
Further Details:      
 
Domain Number 3 Region: 340-570
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-51
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 4 Region: 943-1202
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-38
Family YWTD domain 0.0000722
Further Details:      
 
Domain Number 5 Region: 1331-1371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1293-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1252-1292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 598-636,890-939
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000377
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 295-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000223
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1210-1262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000887
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007756   Gene: ENSBTAG00000005903   Transcript: ENSBTAT00000007756
Sequence length 1611
Comment pep:known chromosome:UMD3.1:29:46485172:46573460:1 gene:ENSBTAG00000005903 transcript:ENSBTAT00000007756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGTEPSVPGCAACSSARILTVCFCPTASPLLLFANRRDVRLVDAGGVKVESTIVVSGLED
AAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGS
TRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKRTGDKRKEILSALYSPMDIQVLSPERQPYYHTRCEEDNG
GCSHLCLLSPREPFYACACPTGVQLQDNGQTCKAGAEEVLLLARRTDLRRISLDTPDFTD
IVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKI
ECANLDGQERHILVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVIDVDGTKRRTLLEDK
LPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAANVAKVVGTNP
CADRNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLDTNN
NDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKP
RIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADD
LPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLN
DCMHNNGQCGQLCLAVPSGHRCSCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDDQ
RSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPSQSQNPDR
QPHDLSIDIYSRTLFWTCEATNTINVHRLNGDAMGMVLRGDRDKPRAIVVNAERGYLYFT
NMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGA
NRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVDKTTGDARTRVQGRVAHLTGIHAV
EDISLEEFSAHPCARDNGGCSHICVAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQF
ACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQ
DRSDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEITKLPSDDGPAHS
SAIGPVIGIILSLFIMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQ
HGPFTGISCGKSMMSSVSLMGGRAGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSP
ATDPSLYNVDVFYSSNIPAAARPYRPYIIRGVAPPTTPCSTDVCDSDYSASRWKASKYYL
DLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences F1N1K8
9913.ENSBTAP00000007756 ENSBTAP00000007756 ENSBTAP00000007756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]