SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007806 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007806
Domain Number 1 Region: 168-425
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.96e-79
Family Eukaryotic proteases 0.0000000101
Further Details:      
 
Domain Number 2 Region: 51-161
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-34
Family Kringle modules 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007806   Gene: ENSBTAG00000005947   Transcript: ENSBTAT00000007806
Sequence length 433
Comment pep:known chromosome:UMD3.1:28:29964983:29971029:1 gene:ENSBTAG00000005947 transcript:ENSBTAT00000007806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLLACLLVCALVVSDSDGSNEVHKESGESNCGCLNGGKCVTYKYFSNIQRCSCPKKFQ
GEHCEIDTSKTCYQGNGHSYRGKANRDLSGRPCLAWDSPTVLLKMYHAHRSDAIQLGLGK
HNYCRNPDNQRRPWCYVQIGLKQFVQFCMVQDCSVGKSPSSPREKEEFQCGQKALRPRFK
IVGGQVTNAENQPWFAAIYRRHRGGSITYLCGGSLISPCWVVSATHCFIDHPKKENYIVY
LGQSRLNSDTRGEMQFEVEKLILHEDYSAESLAHHNDIALLKIRTSRGQCAQPSRSIQTI
CLPPEHEDAHSRTRCEITGFGKENPSDYRYSDELKMTFVSLVSHEVCQQPHYYGAEVTDK
MLCAADPQWETDSCQGDSGGPLVCTIQGRLTLTGIVSWGRDCAMKYKPGVYTRVSKFLPW
INTHTRGEINLVL
Download sequence
Identical sequences Q05589
NP_776572.1.59421 NP_776572.1.76553 XP_005226381.1.76553 XP_015316474.1.76553 XP_019809718.1.53367 XP_019809719.1.53367 ENSBTAP00000007806 9913.ENSBTAP00000007806 ENSBTAP00000007806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]