SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007834 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007834
Domain Number 1 Region: 151-346
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.74e-59
Family Astacin 0.00007
Further Details:      
 
Domain Number 2 Region: 778-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-38
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 353-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-36
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 4 Region: 462-571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 5 Region: 618-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 6 Region: 909-1002
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 7 Region: 729-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000639
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 574-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000861
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007834   Gene: ENSBTAG00000005968   Transcript: ENSBTAT00000007834
Sequence length 1013
Comment pep:known chromosome:UMD3.1:17:1491333:1819993:1 gene:ENSBTAG00000005968 transcript:ENSBTAT00000007834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLERLSPGMLAWLAATGAVLCAELRVCAGLDYDYTFGGYGEDEAEALDYKDPCKAAVFW
GDIALDDEDLNIFQIDRTIDLTQNPFGKFGHITGGFGDHGMSKKRGALYQLIDRIRRIGS
GLEQNNTVKEKLPLKFSGQSEKNRVPRAATSRTERVWPGGVIPYVIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFIERGDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPAEVNSLGESYDFDSIMHYA
RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNL
SSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKLPEVLTSTESRMWIEFRSSSNWVGKGFAAIYEAICGGEIHKNEGQIQSPNYPD
DYRPMKECVWKIAVSEDCYVGLIFQAFEIERHDNCAYDYLEVRDGTNESSPLIGRFCGYD
KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQHCLNTLGSYQCA
CEPGYELGPDRRTCEAACGGLLTKLNGTITTPGWPKEYPPNKHCIWQVVAPTQYRISVKF
EFFELEGNEVCKYDYVEIWSGLSSESKLHGKYCGAEVPEVITSHFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECVNTMGSYLCQCRNGFVLHENKHDCKEAECEQKIHS
PSGFITSPNWPDKYPSRKECTWEISATPGHRVKLAFTEFEIEQHQECAYDHLEVFDGETE
KSPVLGRLCGNKIPEPLVATGNNMFVRFVSDASVQRKGFQAAHSTECGGRLKVESKPRDL
YSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQIFEVEEEADCGYDYVELFDGLDSTAV
GLGRFCGSGPPEEIYSIGDTVLIHFHTDDTISKKGFHIRYKSIRYPDSTHTKK
Download sequence
Identical sequences F1N0X6
ENSBTAP00000007834 NP_001180043.1.59421 NP_001180043.1.76553 ENSBTAP00000007834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]