SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007877 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007877
Domain Number 1 Region: 334-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-30
Family SPRY domain 0.0025
Further Details:      
 
Domain Number 2 Region: 156-268
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-18
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007877   Gene: ENSBTAG00000005999   Transcript: ENSBTAT00000007877
Sequence length 496
Comment pep:known chromosome:UMD3.1:7:20979098:20990894:-1 gene:ENSBTAG00000005999 transcript:ENSBTAT00000007877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDQKEALRKIITTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE
LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLLATDSKDFPQAAKQI
KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERRMLQALTFLPVPSAPVIDLTESLVADN
CVTLVWRMPDEDNKIDHFVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK
YMNFRVKACNKAVSGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI
KAREKDGKGRTASPVNSPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
RYEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKAKMLDAPVPD
CLGVHCDFHQGLLSFYNGRTKQLLHTFKAKFTQPLLPAFTVWCGSFHVTTGLQVPSSVRC
LQKRGSATSSSNTSLT
Download sequence
Identical sequences Q05B84
ENSBTAP00000007877 NP_001074987.1.59421 NP_001074987.1.76553 XP_005896027.1.15283 XP_019820000.1.53367 9913.ENSBTAP00000007877 ENSBTAP00000007877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]