SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007883 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007883
Domain Number 1 Region: 17-239
Classification Level Classification E-value
Superfamily L domain-like 3.33e-44
Family Internalin LRR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007883   Gene: ENSBTAG00000006004   Transcript: ENSBTAT00000007883
Sequence length 347
Comment pep:known_by_projection chromosome:UMD3.1:14:75577519:75651194:-1 gene:ENSBTAG00000006004 transcript:ENSBTAT00000007883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERLLIRALKGGKNTKIVILNGKNITKMPSVLEKLPGLKTLYLQNNQISKVCPEISNLT
QLTALNLGNNLLEEVPEEMKYLTSLKKLHLFRNKIHRFASGVCDGLQSLILLNLNNNQLT
WIPQEISRLKNLRCLSINHNQLASIPRELCFLENLSELQLNYNQLVCIPKEIKFLKKLRK
LLLSRNNIKSLPEGLCNLFNLRILDVAGNVIQMFPPGFQDLKLREFYCEGNPLFLKQPVS
AIKQEDVWSLQEITSRFIMNQLAEKNPFLMKAIKWYPQVRSIISQGRKCAICEKFFLTIW
LECVEFFPPSKNWKISRNLQLVPLRILICSYKCFYQRNPNIFGIAQV
Download sequence
Identical sequences E1BCQ7
XP_002692892.2.76553 XP_874339.3.59421 9913.ENSBTAP00000007883 ENSBTAP00000007883 ENSBTAP00000007883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]