SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000007896 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000007896
Domain Number 1 Region: 2206-2300
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-31
Family Link domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1582-1734
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-30
Family FAS1 domain 0.001
Further Details:      
 
Domain Number 3 Region: 986-1137
Classification Level Classification E-value
Superfamily FAS1 domain 1.31e-25
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 4 Region: 527-663
Classification Level Classification E-value
Superfamily FAS1 domain 7.06e-25
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 5 Region: 1743-1890
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-24
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 1145-1273
Classification Level Classification E-value
Superfamily FAS1 domain 4.19e-21
Family FAS1 domain 0.0059
Further Details:      
 
Domain Number 7 Region: 346-511
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-20
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 8 Region: 2296-2455
Classification Level Classification E-value
Superfamily FAS1 domain 9.03e-20
Family FAS1 domain 0.0091
Further Details:      
 
Domain Number 9 Region: 1477-1534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000914
Family EGF-type module 0.054
Further Details:      
 
Domain Number 10 Region: 1518-1576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000248
Family EGF-like domain of nidogen-1 0.037
Further Details:      
 
Domain Number 11 Region: 242-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000553
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000007896   Gene: ENSBTAG00000006010   Transcript: ENSBTAT00000007896
Sequence length 2558
Comment pep:known chromosome:UMD3.1:5:67612447:67784730:1 gene:ENSBTAG00000006010 transcript:ENSBTAT00000007896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRSSEYFLTMLQSVILFFLGLVVQNLCFLSETAEQGKRCDKKSLLTIRTECQSCSVNFGM
KCPDGYTKITNGTPGIRDCRYTFEVRAYSLSLPGCRHICRKDYLQPQCCPGHWGPDCMEC
PGGARSPCSGRGRCAEGMEGNGSCLCQEGFSGTACEICAADNVFGPNCSAVCSCVHGVCN
SGIHGDGTCECYSGYTGRNCDEPILECAALLCPENSRCSPSSKDEIKLECKCLPNYKGDG
KHCEPINPCSQNICHPHARCTYLGPNQHRCTCQEGYRGDGQVCLPVDPCQVNFGNCPTES
TVCRYSGPGQAYCECKQHYRNFVPGVGCSMTDVCESNNPCHTHADCTTIAPGQTKCTCRK
GYVGDGSTCYGNIMELLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSNLGPFTVLLPTD
KGLKGFNVNEFLLDNKAAQYFVKLHIIAGQMSTEQMNNTDTFYTLTGKSGEIFSEDKDNQ
LKLKLYGSKKTVKIIQGNILASNGLLHILDRAMDKVVPTFESNTEQTIMTMLQPRYSKFR
SLLEKTSVGHALNEDGVGGPYTVFVPSDEALNNMKDGTLDYLLSSEGSRKLLELIRYHIV
PFTQLEVATLISTPHIRSMANQIIRFNTTNNGQILANGVALEEMEVAAKNGRIYTLTGVL
IPPSIIPILPHRCDETKREMRLGTCVSCSLVYRSKCPADSEPTTLFVHKCIYTGRIRSPK
NGCARYCNATVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCTDGLDGNGTCVCQDGFRG
TQCQFCSDPSKYGPRCDTTCPCIFGTCDNRIDSDGACLPGSCRNGSAGRFCHKQTSACGP
YVQFCHIHGTCEYSDGTASCVCKPGYEGDGSFCVEMDPCSGSIPGGCSRYAECIRTGRGT
HTCVCREGWTGDGRDCSEINPCLLPSAGSCHHNATCLYVGPGQNECECKKGFQGNGIDCE
PITSCLEQTEKCHPLATCQLTSSGIWSCVCQEGYEGDGLLCYGNAAVELSFLSAAAVFNQ
WINNASLQHLLSTTSNLTVLVPSRQAIADMDQEEKAFWLTKSNIPVLIKYHTLLGTYGVA
DLQALSPSDMLATSLQGNFLQLVKADGNITIEGASVIDGDNAATNGVIHIINKVLIPQRG
LTGSLPNLLTRLDQMPDYSSFRGYIIQYNLATAIEAADAYTVFAPNNDAIESYIREKKVT
TLEEDILRYHVVLEEKLLKNDLHNGMHRETMLGFSYLLGFFLHDDQLYVNEAPINYTNVA
TDKGVIHGLGKVLEIQKNRCDINDTTIVRGKCGKCPQPPICPFGTKPLGQEMRRCLYTIY
FMGRRSPFLGCQPKCVKTVITRECCAGYFGPQCQPCPGKPENVCFGNGICLDGVNGTGVC
ECGRGFSGTACETCAEGKYGIHCDQVCTCVHGRCNQGLLGDGSCDCDVGWRGVKCDSAIT
KDNCNGTCHTSANCLLNLDGTALCKCAAGFQGNGTICTAINACEISNGGCSAKAVCKRTT
PGSRVCVCKAGYTGDGIVCIEINPCLENHGGCHRHAECTQTGPNQAVCNCLPNYTGDGKV
CTLINVCLTNNGGCSEFAICNHTGQDERTCTCKPDYVGDGFTCRGNIHQELPKNPKTSQF
YFQLLEHSVRDLVGPGPFTVLAPLSAAFDEEPQIKDWDKGGLMPQILRYHVIACHQLLLE
NLKLTPNATSLQGESLVISVSQDMVLINNKARIISSDILCTNGIIHVIDKLLSPQNLLIT
PKDASGMILQNLTTVAMNHGYGKFSNLIQDSGLLSVITDPIHTPVTLFWPSDQALQALPR
EQQDFLFNQDNKDKLKEYLKFHVIRDAKVLAVDLPKFAPWKTLQGSELSVKCGAGSDIGD
LFLNSQTCRIVQRELLFDLGVAYGIDCLLIDPTLGGRCDTFTTFDVSGNCGNCIFTPSCP
KWTKPKGQKQKCLYDLPFKRNLEGCRQLCTLVIQLPKCCKGYFWPDCQACPGGPDTPCNN
RGICLDPYSPSRQCQCNSGFNGTTCELCWPGRFGPDCQPCGCSDHGQCDDGITGSGECIC
ETGWTGRFCDTQTALAPVCTPPCSAHATCKNNNTCECNLNYEGDGITCTVVDFCKQNNGG
CAKVAKCSQKGTKVSCSCQKGYQGDGHSCTAIDPCADGLNGRCHEHATCKMTGPGKHKCE
CKSHYVGDGLDCEPEQLPIDRCLQDNGQCHANADCADLHFQDTTVGVFHLRSPLGQYKLT
FDKAREACAQEAATMATYNQLSYAQKAKYHLCSAGWLDSGRVAYPTSYASQNCGSGIVGI
VDYGPRNNKSEMWDVFCYRMKDVNCTCKVGYVGDGFSCSGNLLQVLMSFPSLTNFLKEVL
VYSNSSARGRAFLKHLTDLSIRSTLFVPQNGGLGENETLSGRDIEHHLSNINIFFYNDLV
NGTIVHTRLGSQLLITSSQDQRQLETRFVDGRAILQWDIFASNGIIHVISKPLKAPSIPG
TPGHTGLGTGVFFAIILVIGAIALAVYSYFRLNRRTIGFQHFESEEDIDVAALGKQQPEN
ISNPMYESTTSATPEPSYDPFTDPADQLLDSSDPLGAL
Download sequence
Identical sequences F1MYW1
ENSBTAP00000007896 ENSBTAP00000007896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]